PMTCDKLPKVPVPPLEEFIKSNPLQFAYVLTDTFDCTTRVYVQPARLSPNQAATALDIRGSRIITNDFVGGPNNSAILNN
CTTGEKATWYFQYTNLNTPNGSSYCAYTCNGEEIAEYKCANNNNGTDPLQKQAVEVAKKVPNGDKIHYALDNCPEHHGCF
AFY
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7yax:A | 166 | 163 | 1.0000 | 0.9819 | 1.0000 | 5.09e-122 | 7yax:B, 7yax:C, 7yax:D, 7ycb:A, 7ycb:B, 7ycb:C, 7ycb:D, 7ycd:A, 7ycd:B, 7ycd:C, 7ycd:D, 7ycf:A, 7ycf:B, 7ycf:C, 7ycf:D, 7yct:A, 7yct:B, 7yct:C, 7yct:D |
2 | 6kfa:A | 162 | 162 | 0.7239 | 0.7284 | 0.7284 | 2.67e-88 | 6kfb:A, 6kfd:A |
3 | 7bpo:A | 165 | 163 | 0.5337 | 0.5273 | 0.5337 | 4.19e-59 | 7bpo:B, 7br1:A, 7br1:B |
4 | 7ry3:C | 1048 | 119 | 0.1779 | 0.0277 | 0.2437 | 1.8 | 7m4p:B |
5 | 6b9o:B | 937 | 86 | 0.1043 | 0.0181 | 0.1977 | 7.7 | 6b9o:A, 6b9p:A, 6b9p:B |
6 | 1sk8:A | 435 | 63 | 0.0920 | 0.0345 | 0.2381 | 7.8 | 1sk9:A |
7 | 3hqp:A | 498 | 57 | 0.1166 | 0.0382 | 0.3333 | 9.0 | 3hqo:K, 3hqo:A, 3hqo:B, 3hqo:C, 3hqp:B, 3hqp:C, 3hqp:D, 3hqp:E, 3hqp:F, 3hqp:G, 3hqp:H, 3hqp:I, 3hqp:J, 3hqp:K, 3hqp:L, 3hqp:M, 3hqp:N, 3hqp:O, 3hqp:P, 3hqq:A, 3hqq:B, 3hqq:C, 3hqq:D, 3hqq:E, 3hqq:F, 3hqq:G, 3hqq:H, 3hqq:I, 3hqq:J, 3hqq:K, 3hqq:L, 3hqq:M, 3hqq:N, 3hqq:O, 3hqq:P, 3hqq:Q, 3hqq:R, 3hqq:S, 3hqq:T, 3hqq:U, 3hqq:V, 3hqq:W, 3hqq:X, 3pp7:B, 3qv6:A, 3qv7:D, 3qv7:A, 3qv8:D, 3srk:A |
8 | 7ttl:C | 617 | 26 | 0.0613 | 0.0162 | 0.3846 | 9.1 | 6n2w:A, 6n2w:B |
9 | 7aat:A | 401 | 35 | 0.0798 | 0.0324 | 0.3714 | 9.1 | 7aat:B, 8aat:A, 8aat:B, 9aat:A, 9aat:B, 1aka:A, 1aka:B, 1akb:A, 1akc:A, 1ama:A, 1ivr:A, 1map:A, 1maq:A, 1oxo:A, 1oxo:B, 1oxp:A, 1tar:A, 1tar:B, 1tas:A, 1tas:B, 1tat:A, 1tat:B |
10 | 7ttj:A | 643 | 26 | 0.0613 | 0.0156 | 0.3846 | 9.2 | 7ttl:B, 3v99:A |
11 | 7ttj:B | 590 | 26 | 0.0613 | 0.0169 | 0.3846 | 9.3 |