BioLiP

>protein
PMPLLINLIVSLLGFVATVTLIPAFRGHFIAARLCGQDLNKTSRQQIPESQGVISGAVFLIILFCFIPFPFLPHHEFVAL
IGALLAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLMVYFTNFGNTTIVVPKPFRPILLDLGILYYVYMGLLAVFCT
NAINILAGINGLEAGQSLVISASIIVFNLVELEGDCRDDHVFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMT
FAGVGILGHFSKTMLLFFMPQVFNFLYSLPQLLHIIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQ
LVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHERNLTLLLLLLQILGSAITFSIRYQLV

The query sequence (length=381) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5o5e:A	381	381	1.0000	1.0000	1.0000	0.0	6bw5:A, 6bw5:B, 6bw5:C, 6bw6:A, 6bw6:B, 6bw6:C, 6bw6:D, 6fm9:A, 6fwz:A
2	6bw5:D	362	382	0.9370	0.9862	0.9346	0.0
3	6oz6:C	322	169	0.1155	0.1366	0.2604	1.25e-06	8cxr:C, 6oz6:B
4	9b70:B	341	265	0.1654	0.1848	0.2377	3.96e-06	9b70:A, 9b71:A, 9b71:B, 5ckr:A, 8cxr:A, 6oyh:A, 6oyh:C, 6oyh:B, 6oyh:D, 6oyz:A, 6oz6:A
5	7yh4:A	400	125	0.0866	0.0825	0.2640	1.3
6	5jnq:A	307	147	0.0919	0.1140	0.2381	1.5
7	5unf:A	386	110	0.0735	0.0725	0.2545	2.3	5unh:A, 5unh:B
8	5ung:B	410	110	0.0735	0.0683	0.2545	2.3	7jni:A, 7jni:B, 6jod:A, 5unf:B
9	6ygb:A	159	40	0.0315	0.0755	0.3000	2.4	6ygc:A, 6ygd:A
10	7kws:A	390	120	0.0761	0.0744	0.2417	3.1	7kws:B
11	8zfk:D	412	39	0.0394	0.0364	0.3846	3.8	8zfk:E, 8zfk:A, 8zfk:B, 8zfk:C
12	3e15:D	295	42	0.0394	0.0508	0.3571	6.5

[Back]