BioLiP

>protein
PMKGRFPIRRTLQYLGRGDVVFKESVKIMTVNYNTYGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLD
SGEQVLVDVETKSNKEIMEHIKKILGKKEETLREEELEKQQRFHPGNFGPRKYCLRECMCEVEGQVPCPGLVPLPKEMTG
KYKAALKAST

The query sequence (length=170) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7pnt:T	170	170	1.0000	1.0000	1.0000	4.14e-126	7a5f:T6, 7a5g:T6, 7a5i:T6, 7a5k:T6, 8any:AT, 8csp:T, 8csq:T, 8csr:T, 8css:T, 8cst:T, 8csu:T, 3j9m:AT, 8k2a:Sa, 7l08:AT, 6nu2:AT, 6nu3:AT, 7og4:AT, 8oir:AT, 8ois:AT, 7p2e:T, 7pnu:T, 7pnv:T, 7pnw:T, 7pnx:T, 7pny:T, 7pnz:T, 7po0:T, 7po1:T, 7po2:T, 7po3:T, 7qi4:AT, 7qi5:AT, 7qi6:AT, 8qrk:T, 8qrl:T, 8qrm:T, 8qrn:T, 6rw4:T, 6rw5:T, 6vlz:AT, 6vmi:AT, 8xt0:Sa, 8xt2:Sa, 6zm5:AT, 6zm6:AT, 6zs9:AT, 6zsa:AT, 6zsb:AT, 6zsc:AT, 6zsd:AT, 6zse:AT, 6zsg:AT
2	3jd5:c	168	168	0.8353	0.8452	0.8452	1.95e-109	6neq:c, 6nf8:c
3	5aj3:c	169	169	0.8882	0.8935	0.8935	1.40e-105	5aj4:Ac, 6gaw:Ac, 6gaz:Ac, 7nqh:Ac, 7nql:Ac, 7nsi:Ac, 7nsj:Ac, 8oin:AT, 8oip:AT, 6ydp:Ac, 6ydw:Ac
4	6ywe:4	137	113	0.1529	0.1898	0.2301	0.058	6yws:4, 6ywv:4, 6ywx:4, 6ywy:4
5	6xyw:AH	110	107	0.1529	0.2364	0.2430	0.23
6	6yws:h	98	86	0.1176	0.2041	0.2326	0.46
7	1zxv:A	728	25	0.0824	0.0192	0.5600	1.9	1j7n:A, 4pkw:A, 1pww:A
8	1jky:A	748	25	0.0824	0.0187	0.5600	1.9	5d1s:A, 5d1t:A, 5d1u:A, 4dv8:A, 1j7n:B, 4pkq:A, 4pkr:A, 4pks:A, 4pkt:A, 4pku:A, 4pkv:A, 1pwp:A, 1pwp:B, 1pwq:A, 1pwq:B, 1pwu:A, 1pwu:B, 1pwv:A, 1pwv:B, 1pww:B, 4wf6:A, 4xm6:A, 4xm7:A, 4xm8:A, 1yqy:A, 1zxv:B
9	7pkt:F	129	96	0.1294	0.1705	0.2292	2.7
10	4z7x:A	211	27	0.0706	0.0569	0.4444	3.8	4z7x:B
11	2nqp:C	264	70	0.1000	0.0644	0.2429	5.8	2nqp:D, 2nr0:A, 2nr0:B, 2nr0:C, 2nr0:D, 2nre:A
12	7qh7:6	292	25	0.0647	0.0377	0.4400	7.1
13	8a9k:A	998	38	0.0647	0.0110	0.2895	7.2
14	1np7:A	483	29	0.0765	0.0269	0.4483	7.3	1np7:B
15	7o9k:6	331	25	0.0647	0.0332	0.4400	7.3	7a5f:63, 7a5g:63, 7a5h:6, 7a5i:63, 7a5j:6, 7a5k:63, 3j7y:6, 3j9m:6, 6nu2:6, 6nu3:6, 7o9m:6, 7of0:6, 7of2:6, 7of3:6, 7of4:6, 7of5:6, 7of6:6, 7of7:6, 7oi6:6, 7oi7:6, 7oi8:6, 7oi9:6, 7oia:6, 7oib:6, 7oic:6, 7oid:6, 7oie:6, 5ool:6, 5oom:6, 7pd3:6, 7qh6:6, 8qu5:6
16	5ebz:A	655	55	0.1000	0.0260	0.3091	7.7	5ebz:B, 5ebz:C, 5ebz:D, 5ebz:E, 5ebz:F, 5ebz:G, 5ebz:H, 5ebz:L, 5ebz:I, 5ebz:K, 5ebz:J
17	7kzv:U	1198	38	0.0647	0.0092	0.2895	7.9	7kzt:U, 6vaa:A, 6vae:A, 6vaf:A
18	1wuw:A	45	25	0.0471	0.1778	0.3200	8.5	1wuw:B
19	8any:6	354	25	0.0647	0.0311	0.4400	9.3	6i9r:6, 8k2a:Ll, 8k2b:Ll, 7l08:6, 7l20:6, 7odr:6, 7ods:6, 7odt:6, 7og4:6, 8oir:Bn, 8oit:Bn, 8pk0:6, 7po4:6, 7qi4:6, 7qi5:6, 7qi6:6, 8qsj:6, 8qu1:6, 6vlz:6, 6vmi:6, 8xt0:Ll, 8xt1:Ll, 8xt2:Ll, 8xt3:Ll, 6zm5:6, 6zm6:6, 6zs9:6, 6zsa:6, 6zsb:6, 6zsc:6, 6zsd:6, 6zse:6, 6zsg:6
20	1ygp:A	858	49	0.0941	0.0186	0.3265	9.6	1ygp:B

[Back]