PMHPFVKALQEHFTAHQNPEKAEPMARYMKNHFLFLGIQTPERRQLLKDIIQIHTLPDQKDFQIIIRELWDLPEREFQAA
ALDIMQKYKKHINETHIPFLEELIVTKSWWDSVDSIVPTFLGDIFLKHPELISAYIPKWIASDNIWLQRAAILFQLKYKQ
KMDEELLFWIIGQLHSSKEFFIQKAIGWVLREYAKTNPDVVWEYVQNNELAPLSKREAIKHIKQNY
The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3jx7:A | 232 | 226 | 1.0000 | 0.9741 | 1.0000 | 1.30e-167 | 5cl3:A, 5cl4:A, 5cl5:A, 5cl6:A, 5cl7:A, 5cl8:A, 5cl9:A, 5cla:A, 5clb:A, 5clc:A, 5cld:A, 5cle:A, 3jxy:A, 3jxz:A, 3jy1:A, 5kub:A, 7lxh:A, 7lxj:A, 5uuf:A, 5uug:A, 5uuh:A |
2 | 4f48:B | 97 | 58 | 0.0619 | 0.1443 | 0.2414 | 0.85 | |
3 | 6xgw:B | 356 | 59 | 0.0752 | 0.0478 | 0.2881 | 0.91 | 6xg8:B, 6xgx:B |
4 | 6xgx:A | 402 | 54 | 0.0664 | 0.0373 | 0.2778 | 3.8 | 6xg8:A, 6xgw:A |
5 | 5yvg:A | 830 | 82 | 0.1018 | 0.0277 | 0.2805 | 5.8 | 2h4m:B, 2ot8:B, 5yvh:A |
6 | 5mqr:A | 1082 | 76 | 0.0841 | 0.0176 | 0.2500 | 6.1 | 5mqs:A |
7 | 3kyq:A | 193 | 20 | 0.0398 | 0.0466 | 0.4500 | 6.3 | |
8 | 8as8:A | 597 | 83 | 0.0929 | 0.0352 | 0.2530 | 7.8 | 8as8:B, 8bfn:A, 8bfn:B, 8bfn:F, 8bfn:G |