PLVYTHGGKLERKSKKDKTASKVFEEFGVMEAYNCWKEASLCIQQRDKDSVLKLVAALNTYKDAVEPIFDSRLNSAQEVL
QPSILEEFFEYLFSRIDSIVGVNIPIRHPAKGYLSLSFNPHNIETLIQSPEYTVRAKDHDFIIGGSAKLTIQGHGGEGET
TNIVVPAVAIECKRYLERNMLDECAGTAERLKRATPYCLYFVVAEYLKLDDGAPELTEIDEIYILRHQRNSERNKPGFKP
NPIDGELIWDLYQEVMNHLGKIWWDPNSALQRGKVF
The query sequence (length=276) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6m9g:A | 280 | 276 | 1.0000 | 0.9857 | 1.0000 | 0.0 | 6eg7:A, 6eg7:B, 6m9g:B |
2 | 6vby:A | 470 | 132 | 0.1304 | 0.0766 | 0.2727 | 4.3 | |
3 | 7mi4:E | 95 | 40 | 0.0399 | 0.1158 | 0.2750 | 5.1 | 7mi4:F, 7mi5:E, 7mi5:F, 7mi9:E, 7mi9:F, 7mib:F, 7mib:E, 7mid:C, 7mid:D |
4 | 4dq6:A | 388 | 77 | 0.0833 | 0.0593 | 0.2987 | 5.8 | 4dgt:A, 4dgt:B, 4dq6:B |
5 | 7cui:A | 173 | 56 | 0.0580 | 0.0925 | 0.2857 | 7.2 | 7cui:C |
6 | 5xz7:A | 322 | 103 | 0.0942 | 0.0807 | 0.2524 | 7.9 | 5xz6:A, 5xz8:A, 5xz9:A, 5xza:A |
7 | 3m34:A | 632 | 60 | 0.0688 | 0.0301 | 0.3167 | 9.1 | 3m6l:A, 3m7i:A |