BioLiP

>protein
PLVVATKPSSEQYILGEILSLLLEKHHIPIKRAFGIGGGTMNIHPALIRGDFDLYVEYTGTAWVNTLKNPLTQKVDFETI
KKRYEKEFNLLWVGLLGFNNTYSLAISKEDAQKYAIETFSDLAFHSPNFDFGAEFDFFEREDAFKGLMKAYRFHFRSLHE
MDINLRYKSFESHKINALDVFTTDAQIKELDLKVLKDDKGFFPNYQAGIVIRKETIKKYPEALKILEKLDSKINDETMQD
LNYQVEVLKKSPKIVAKDFLERLGL

The query sequence (length=265) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8dp7:A	265	265	1.0000	1.0000	1.0000	0.0	8dp7:B, 8dp7:C, 8dp7:D, 8dp7:E
2	7s7x:A	278	271	0.3849	0.3669	0.3764	1.93e-57	7s7x:B, 7s7x:C, 6v1r:A
3	1sw1:A	270	268	0.3472	0.3407	0.3433	2.81e-47	1sw1:B, 1sw4:A, 1sw4:B
4	7s7t:A	509	189	0.2943	0.1532	0.4127	8.33e-46	8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
5	7s7t:A	509	74	0.0868	0.0452	0.3108	0.090	8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
6	3ppo:A	272	267	0.3396	0.3309	0.3371	2.31e-45	3ppo:B, 3ppq:A, 3ppq:B, 3ppr:A, 3ppr:B
7	7txl:A	275	273	0.3585	0.3455	0.3480	1.44e-44	7txk:A, 7txk:B, 7txl:B
8	6eyh:A	280	264	0.3283	0.3107	0.3295	1.27e-42	6eyl:A, 6eyl:B, 5nxy:A, 5nxy:C, 3r6u:A
9	1uwk:A	554	100	0.1019	0.0487	0.2700	1.1	1uwk:B, 1uwl:A, 1uwl:B, 2v7g:A, 2v7g:B, 2v7g:C, 2v7g:D, 1w1u:A, 1w1u:B
10	6ntz:A	367	75	0.0830	0.0599	0.2933	3.8	3beb:A, 3bec:A, 5j8x:A, 3mzd:A, 3mze:A, 3mzf:A, 1z6f:A
11	8h1l:B	423	45	0.0528	0.0331	0.3111	5.4	8h1l:C, 8h1n:A
12	6lla:B	363	39	0.0528	0.0386	0.3590	6.2	6lk2:A, 6lk2:B, 6lk2:C, 6lk2:D, 6lla:A, 6lla:C, 6lla:D

[Back]