BioLiP

>protein
PLVFLCSGCRRPLGDSLSWVATNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKR
DLFCLSVEAIESYVLG

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7sfz:A	100	100	0.9688	0.9300	0.9300	8.34e-59	7sfz:B, 7sfz:C, 7sfz:D, 7sfz:E, 7sfz:F, 7sfz:G
2	7sfz:H	84	96	0.8646	0.9881	0.8646	6.11e-50
3	5j6p:B	102	101	0.3542	0.3333	0.3366	2.43e-11	5hj0:A, 5hj0:B, 5hj0:C, 5j6p:A, 5j6p:C
4	6mqc:A	222	74	0.2083	0.0901	0.2703	1.1	6mqc:H
5	7x6v:A	1381	59	0.1562	0.0109	0.2542	2.6
6	6n16:H	219	51	0.1458	0.0639	0.2745	2.7	6n16:A, 6n16:K, 6n16:C
7	7x6s:A	1453	59	0.1562	0.0103	0.2542	2.9	5ltf:A, 5ltn:A, 5ltn:B, 5t2t:A
8	4ak2:A	286	21	0.0833	0.0280	0.3810	4.0
9	7r81:L2	90	24	0.1042	0.1111	0.4167	4.7	7olc:SK, 7old:SK, 8oo0:SK, 7z3n:SK, 7z3o:SK
10	3adp:A	310	17	0.0833	0.0258	0.4706	5.2
11	3hci:A	153	47	0.1354	0.0850	0.2766	5.9	3hci:B, 3hcj:A, 3hcj:B
12	4d0l:E	479	50	0.1146	0.0230	0.2200	7.4	5c4g:E, 4d0l:A, 4d0l:C, 4d0m:A, 4d0m:C, 4d0m:G, 4d0m:I, 4d0m:M, 4d0m:O, 4d0m:Q, 4d0m:S, 4d0m:W, 4d0m:Y, 4d0m:c, 4d0m:g, 5euq:E, 5fbl:A, 5fbq:A, 5fbr:A, 5fbv:A, 5fbw:A, 6gl3:A, 8q6f:A, 8q6g:A, 8q6h:A, 8vof:A, 4wae:A, 4wag:A
13	6tr8:A	136	53	0.1458	0.1029	0.2642	7.9
14	1wyh:A	72	12	0.0938	0.1250	0.7500	8.5
15	7ena:2	385	32	0.1250	0.0312	0.3750	8.6	8bvw:4, 8byq:4, 8ebs:E, 8ebt:E, 8ebu:E, 8ebv:E, 8ebw:E, 8ebx:E, 8eby:E, 7egb:2, 7egc:2, 7enc:2, 8gxq:HG, 8gxs:HG, 7lbm:a, 7nvr:6, 7nvw:6, 7nvx:6, 7nvy:6, 7nvz:6, 7nw0:6, 6o9l:6, 6o9m:6, 8wak:2, 8wal:2, 8wan:2, 8wao:2, 8wap:2, 8waq:2, 8war:2, 8was:2, 1z60:A

[Back]