PLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVDQPWTNWQEALD
HVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQG
DWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRDAGE
VTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAIFVWYG
LLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRAS
NIDPARVLS
The query sequence (length=409) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7arh:E | 409 | 409 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7arl:E, 7mdx:B, 7v8l:E |
2 | 7v8l:C | 396 | 412 | 0.2689 | 0.2778 | 0.2670 | 8.11e-36 | 7arh:C, 7arj:C, 7arl:C, 7arm:C, 7mdx:A |
3 | 5lil:A | 615 | 254 | 0.1296 | 0.0862 | 0.2087 | 0.003 | 5lil:B, 5lj6:A, 5lj7:B |
4 | 5lj7:A | 592 | 207 | 0.1076 | 0.0743 | 0.2126 | 0.006 | |
5 | 3wc3:A | 435 | 60 | 0.0538 | 0.0506 | 0.3667 | 0.18 | 8ihw:A, 8ihx:A, 8ihy:A |
6 | 7aih:Ar | 195 | 38 | 0.0318 | 0.0667 | 0.3421 | 0.61 | 7am2:Ar, 7ane:Ar |
7 | 6yxx:BR | 196 | 37 | 0.0318 | 0.0663 | 0.3514 | 0.97 | 7aoi:BR, 6hiv:BR, 6hix:BR, 6yxy:BR |
8 | 4c1w:A | 188 | 37 | 0.0440 | 0.0957 | 0.4865 | 2.2 | 4c1x:A |
9 | 4ol8:F | 427 | 113 | 0.0733 | 0.0703 | 0.2655 | 2.9 | 4ol8:A |
10 | 4fsp:A | 364 | 96 | 0.0562 | 0.0632 | 0.2396 | 4.4 | |
11 | 6x0o:A | 1037 | 49 | 0.0367 | 0.0145 | 0.3061 | 5.3 | |
12 | 1xvl:A | 279 | 100 | 0.0636 | 0.0932 | 0.2600 | 5.4 | 4irm:A, 4irm:B, 3ujp:A, 3ujp:B, 3ujp:C, 1xvl:B |
13 | 7bvc:B | 1063 | 49 | 0.0367 | 0.0141 | 0.3061 | 5.5 | 7bvg:B, 7bwr:A |
14 | 8csp:5 | 319 | 27 | 0.0318 | 0.0408 | 0.4815 | 9.7 | 6aax:A, 6aax:C, 6ajk:A, 8csq:5, 8csr:5, 8csu:5 |