BioLiP

>protein
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQA
YVHHQALLDVKNIAHQNKF

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3c5k:A	108	99	1.0000	0.9167	1.0000	2.57e-70	5b8d:A, 6ce6:A, 6ce8:A, 6cea:A, 6cec:A, 6ced:A, 6cee:A, 6cef:A, 8g43:A, 8g44:A, 8g45:A, 3gv4:A, 5kh3:A, 5kh7:A, 5kh9:A, 3phd:A, 3phd:B, 3phd:C, 3phd:D, 5wbn:A, 5wpb:A, 7zyu:A
2	5g0f:A	110	99	0.6061	0.5455	0.6061	6.98e-43
3	6kcz:A	99	89	0.2626	0.2626	0.2921	5.08e-05
4	2uzg:A	95	83	0.2828	0.2947	0.3373	7.40e-05
5	2i50:A	122	54	0.2121	0.1721	0.3889	0.005
6	2l80:A	114	80	0.2020	0.1754	0.2500	0.009
7	4wa6:D	415	78	0.2020	0.0482	0.2564	0.010	4w4u:D
8	3mhs:A	455	78	0.2020	0.0440	0.2564	0.013	6aqr:A, 4fip:A, 4fip:E, 4fjc:A, 4fk5:A, 6t9l:K, 4w4u:A, 4wa6:A, 4zux:U, 4zux:Z, 4zux:e, 4zux:j
9	4fjc:E	434	79	0.2020	0.0461	0.2532	0.014	3m99:A, 3mhh:A
10	3ihp:B	681	48	0.1414	0.0206	0.2917	0.13	6dxh:A, 6dxt:A, 6dxt:B, 2g43:A, 2g43:B, 2g45:A, 2g45:D, 3ihp:A, 7ms5:A, 7ms5:B, 7ms6:A, 7ms7:A, 7ms7:B, 6nft:A, 6nft:B, 6p9g:A
11	7oik:A	4426	27	0.1313	0.0029	0.4815	0.30	7oim:A, 6tax:A, 6tay:A
12	4hsr:B	535	42	0.1515	0.0280	0.3571	1.7	4hst:B
13	6dgd:A	704	40	0.1414	0.0199	0.3500	3.1	6dgd:B, 4nl4:H
14	2ida:A	102	67	0.1919	0.1863	0.2836	3.7
15	7dn3:B	1044	16	0.0707	0.0067	0.4375	9.2	7du2:B
16	8ity:B	1105	16	0.0707	0.0063	0.4375	9.2	7a6h:B, 7ae1:B, 7ae3:B, 7aea:B, 7d58:B, 7d59:B, 7fji:B, 7fjj:B, 8iue:B, 8iuh:B

[Back]