PLKDRRLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSVAGLSMVLAAYVVFNYCRSYKELKHERLR
KYH
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6j54:f | 87 | 83 | 1.0000 | 0.9540 | 1.0000 | 6.24e-58 | 6zbb:f, 6zmr:f, 6zpo:f, 6zqm:f, 6zqn:f |
2 | 6ofc:B | 669 | 56 | 0.2048 | 0.0254 | 0.3036 | 0.75 | 3dla:A, 3dla:D, 3dla:C, 6ofc:A, 6ofc:D, 6ofc:C, 3seq:A, 3seq:B, 3sez:A, 3sez:B, 3syt:A, 3syt:B, 3syt:C, 3szg:A, 3szg:D, 3szg:C |
3 | 3seq:D | 650 | 56 | 0.2048 | 0.0262 | 0.3036 | 0.86 | 3dla:B, 3seq:C, 3sez:D, 3sez:C, 3syt:D, 3szg:B |
4 | 6td5:I | 219 | 38 | 0.1566 | 0.0594 | 0.3421 | 1.2 | 6td5:i |
5 | 7dzz:B | 268 | 18 | 0.1084 | 0.0336 | 0.5000 | 2.8 | 7dt0:A, 7dt0:B, 7dt0:C, 7dt0:D, 7dt0:E, 7dt0:F, 7dt0:G, 7dzz:A, 7e00:A, 7e00:B, 7e01:A, 7e06:A, 7e06:B, 7e07:A, 7e07:B, 7e08:A, 7e09:A, 8h7v:A, 8h7v:B, 8h7y:A, 8h7y:B, 8h81:A, 8h85:A |
6 | 7dt0:H | 241 | 18 | 0.1084 | 0.0373 | 0.5000 | 4.2 | |
7 | 3e80:C | 747 | 30 | 0.1325 | 0.0147 | 0.3667 | 5.6 | 3e7j:A, 3e7j:B, 3e80:A, 3e80:B, 2fuq:B, 2fuq:A, 2fut:A, 2fut:B |
8 | 6wq2:A | 154 | 62 | 0.2169 | 0.1169 | 0.2903 | 6.8 | 6wq2:B, 6wq2:C, 6wq2:D, 6wq2:E, 6wq2:F, 6wq2:G, 6wq2:H, 6wq2:I, 6wq2:J, 6wq2:K, 6wq2:L, 6wq2:M, 6wq2:N, 6wq2:P, 6wq2:R, 6wq2:T |