PLGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSRTEEYALGVVGVLESYIGSINNI
TKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKS
ITIN
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4c3b:C | 178 | 178 | 1.0000 | 0.9213 | 0.9213 | 9.39e-118 | 4c3b:A, 4c3b:B, 4c3b:D, 4c3b:E, 4c3b:F, 4c3b:G, 4c3b:H, 4c3b:I, 4c3b:J, 4c3b:K, 4c3b:L, 4c3b:M, 4c3b:N, 4c3b:O, 4c3b:P, 4c3e:A, 4c3e:B, 4c3e:C, 4c3e:D, 4c3e:E, 4c3e:F, 4c3e:G, 4c3e:H, 4c3e:I, 4c3e:J, 4c3e:K, 4c3e:L, 4c3e:M, 4c3e:N, 4c3e:O, 4c3e:P, 6g0y:F, 6g0y:E, 6g0y:A, 6g0y:C, 6pzq:B, 6pzq:D |
2 | 6pzq:A | 157 | 160 | 0.9573 | 1.0000 | 0.9812 | 8.14e-114 | 6pzq:C |
3 | 4cs7:C | 172 | 164 | 0.3537 | 0.3372 | 0.3537 | 7.19e-35 | 4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E |
4 | 2cqe:A | 98 | 22 | 0.0671 | 0.1122 | 0.5000 | 0.96 | |
5 | 2cqe:A | 98 | 26 | 0.0610 | 0.1020 | 0.3846 | 8.8 | |
6 | 7k95:A | 53 | 30 | 0.0732 | 0.2264 | 0.4000 | 1.5 | 7zyh:A, 7zyh:D, 7zyh:G, 7zyh:J |
7 | 6xr0:M | 683 | 44 | 0.0854 | 0.0205 | 0.3182 | 3.2 | |
8 | 3kak:B | 437 | 43 | 0.1037 | 0.0389 | 0.3953 | 3.9 | |
9 | 3kal:A | 470 | 43 | 0.1037 | 0.0362 | 0.3953 | 4.2 | 3kak:A, 3kal:B |
10 | 2zba:D | 391 | 49 | 0.0976 | 0.0409 | 0.3265 | 4.4 | |
11 | 2zba:A | 435 | 49 | 0.0976 | 0.0368 | 0.3265 | 4.4 | 2zba:B, 2zba:C |
12 | 6pwy:B | 513 | 38 | 0.0854 | 0.0273 | 0.3684 | 5.9 | 6pwy:A, 6pwy:D, 6pwy:C |
13 | 8ro0:O | 342 | 36 | 0.0854 | 0.0409 | 0.3889 | 6.6 | 8ro1:O |
14 | 2d9n:A | 77 | 21 | 0.0610 | 0.1299 | 0.4762 | 7.8 | 2rhk:C |
15 | 4ii1:B | 139 | 21 | 0.0549 | 0.0647 | 0.4286 | 9.9 | 4ii1:A, 4ii1:C, 4ii1:D |