Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
PLGSGVPKEIQLAELREALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPALVDAEALLGTVKALLHDRYEIEHSTLQL
ETSAC

The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6vd8:A 85 85 1.0000 1.0000 1.0000 1.86e-56 6vd8:B
2 6xpd:B 303 81 0.2824 0.0792 0.2963 2.21e-08 6xpd:A, 6xpe:B, 6xpe:A
3 7y5g:B 302 80 0.2471 0.0695 0.2625 1.05e-07 7y5g:A, 7y5h:B, 7y5h:A
4 8zsz:A 315 77 0.2941 0.0794 0.3247 1.79e-05 8zsb:A, 8zsb:B, 8zsz:B
5 7cdl:C 573 70 0.2235 0.0332 0.2714 1.3 7cdl:D, 7cdl:A, 7cdl:B, 7cdl:G, 7cdl:H, 7cdl:M, 7cdl:N, 7ce5:A, 7ce5:B, 7ce5:C, 7ce5:D, 7ce5:G, 7ce5:H, 7ce5:M, 7ce5:N, 7ce9:A, 7ce9:B, 7ce9:C, 7ce9:D, 7ce9:G, 7ce9:H, 7ce9:M, 7ce9:N, 7cfx:C, 7cfx:D, 7cfx:A, 7cfx:B, 7cfx:G, 7cfx:H, 7cfx:M, 7cfx:N, 4tqo:B, 4tqo:A, 4tqo:C, 4tqo:D, 4tqo:E, 4tqo:F, 4tqo:G, 4tqo:H
6 6efv:A 530 33 0.1412 0.0226 0.3636 3.5 1ddg:A, 1ddg:B, 1ddi:A, 1ykg:A
7 1ibj:A 380 49 0.1529 0.0342 0.2653 3.7 1ibj:C
8 5mdn:A 761 25 0.1294 0.0145 0.4400 4.8 5mdn:B
9 6jij:C 298 43 0.1647 0.0470 0.3256 7.3 6jij:B, 6jij:A
10 3emy:A 329 26 0.1412 0.0365 0.4615 8.5

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218