BioLiP

>protein
PKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSA
REAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCCRAERRVVPLVQMGETDANVAKFLNR
LSDYLFTLARYAAMKEGNQEKIYMKN

The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7rut:E	187	186	0.9624	0.9572	0.9624	1.33e-131	6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C
2	3ci1:A	188	182	0.3763	0.3723	0.3846	1.49e-38	3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B
3	3ke5:A	182	172	0.3871	0.3956	0.4186	6.66e-32	3ke5:C, 3ke5:B
4	2zhz:B	174	184	0.3763	0.4023	0.3804	1.65e-31	2zhz:A, 2zhz:C
5	8d32:A	186	174	0.3387	0.3387	0.3621	1.70e-20	6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C
6	7kq8:A	294	71	0.1129	0.0714	0.2958	6.7	7kq8:B, 7kq8:C, 7kq8:D, 7l5c:A, 7l5c:B, 7l5c:C, 7m8h:A, 7m8h:B, 7m8h:C, 7m8h:D
7	7yp3:F	419	76	0.1237	0.0549	0.3026	8.6	7yp3:B, 7yp3:C, 7yp3:D, 7yp3:E, 7yp5:A, 7yp5:B, 7yp6:A, 7yp6:B
8	2d43:A	482	72	0.1183	0.0456	0.3056	8.9	2d44:A, 6sxr:A, 6sxs:AAA, 6sxt:A, 1wd4:A

[Back]