PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQQEKFNQMEYNKLMLENVSRVRAMCTEILKM
SVLNQESIASGNFDYAVIKPAIDKFAREQVSIFFPDDEDDQ
The query sequence (length=121) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3on0:A | 121 | 121 | 1.0000 | 1.0000 | 1.0000 | 1.35e-86 | 3omy:B, 3on0:B, 3on0:C, 3on0:D |
2 | 4qpq:B | 52 | 52 | 0.1983 | 0.4615 | 0.4615 | 2.50e-09 | 4qpq:A, 4qpq:C, 4qpq:D, 4qpq:E, 4qpq:F, 4qpq:G, 4qpq:H |
3 | 3d8a:D | 63 | 62 | 0.1653 | 0.3175 | 0.3226 | 1.99e-04 | 3d8a:B, 3d8a:C, 3d8a:A, 3d8a:H, 3d8a:E, 3d8a:F |
4 | 5y0t:A | 414 | 26 | 0.0909 | 0.0266 | 0.4231 | 3.0 | 5y0t:B, 5y0t:C, 5y0t:D |
5 | 5v8f:7 | 725 | 103 | 0.2149 | 0.0359 | 0.2524 | 6.2 | 8b9a:7, 8b9b:7, 8b9c:7, 3jc6:7, 3jc7:7, 8kg6:7, 8kg8:7, 8p5e:7, 8p62:7, 8p63:7, 7pt6:7, 7pt6:G, 7pt7:7, 7pt7:G, 7qhs:7, 6rqc:7, 6sko:7, 8w7m:7, 7z13:7, 7z13:f |
6 | 2wcu:A | 149 | 59 | 0.1322 | 0.1074 | 0.2712 | 6.5 | 2wcu:B |
7 | 8h40:E | 620 | 61 | 0.1405 | 0.0274 | 0.2787 | 8.4 | |
8 | 7v3u:7 | 699 | 103 | 0.2066 | 0.0358 | 0.2427 | 8.7 | 5bk4:F, 5bk4:7, 6eyc:7, 3ja8:7, 7p30:7, 7p30:F, 7p5z:7, 7p5z:F, 7v3u:G, 7v3v:7, 7v3v:G, 7w8g:7, 7w8g:G |
9 | 7k3p:A | 329 | 132 | 0.2727 | 0.1003 | 0.2500 | 9.8 | 7k3p:B |
10 | 2rmx:A | 118 | 21 | 0.0909 | 0.0932 | 0.5238 | 9.9 | 2yu7:A |