BioLiP

>protein
PKFIAVKLIPKGPFRDIPRADTLFGAIGNAISAIHGQSAVEELVDAFVGGARISSAFPYSGDTYYLPKPLSVEPALEGIL
TGLDEEERYTTAKRLRKAKYLDLKNFELALRLRPFTIPEEIPYARVDVPRVVLDRVTQDSSIYFWEEIRFREKSGVYFLY
SGPREVFDGYIAPAMRFLGDTGIGGKSTWGAGLFEVEFHEMKIDAPGSEYSVTLSNALPTKTPVLWRLLRKGGWSFGRRK
PRMTFIAEGSIVKNDPGGMERLELGLSHEVYVYGLTFPLGVELPEG

The query sequence (length=286) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6mur:E	286	286	1.0000	1.0000	1.0000	0.0	6iqw:E, 6mus:E, 6mut:E, 6muu:E, 6o7e:E, 6o7h:E, 6o7i:E
2	6o7b:B	254	286	0.8881	1.0000	0.8881	3.27e-173	6o78:B
3	7v01:H	297	213	0.2028	0.1953	0.2723	1.22e-07	8do6:B, 7uzw:H, 7uzx:H, 7uzy:H, 7uzz:H, 7v00:H, 7v02:H
4	8wfx:M	296	274	0.2413	0.2331	0.2518	1.12e-06
5	6ifn:B	297	231	0.1923	0.1852	0.2381	4.44e-06	6ifk:B, 6ifr:B, 6ify:B, 6ifz:B, 6ig0:B, 6nud:I, 6nue:I
6	9ash:B	297	287	0.2378	0.2290	0.2369	8.72e-05	9asi:B, 6xn5:B
7	6xn7:B	277	287	0.2308	0.2383	0.2300	0.012	6xn3:B, 6xn4:B
8	6ifl:G	273	145	0.1119	0.1172	0.2207	0.23	6ifu:G
9	5hdt:A	1085	57	0.0804	0.0212	0.4035	3.1	5hdt:B
10	8e73:G2	258	62	0.0490	0.0543	0.2258	3.5	6x89:G2
11	6ysw:A	707	47	0.0664	0.0269	0.4043	6.6
12	7xr5:A	289	31	0.0559	0.0554	0.5161	7.0	7xr5:B, 7xr5:C, 7xr5:D

[Back]