BioLiP

>protein
PITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVRLGVQLVGTTRFAEFLPA
LPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLAGGRLDD
TFVYSITDHEWPQVKAALEASF

The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1yre:B	187	182	1.0000	0.9733	1.0000	1.02e-133	1yre:A, 1yre:C, 1yre:D
2	8gxk:B	188	182	0.7912	0.7660	0.7912	1.68e-106	8gxk:A, 8gxk:C, 8gxk:D
3	8gxf:B	187	182	0.6758	0.6578	0.6758	1.80e-85	8gxf:A, 8gxf:C, 8gxf:D
4	6c32:A	209	189	0.2527	0.2201	0.2434	1.67e-07	6c37:A
5	7kyj:B	194	63	0.1319	0.1237	0.3810	4.27e-04	6edd:A, 6edd:B, 6edv:A, 7kpp:A, 7kpp:B, 7kps:A, 7kps:B, 7kye:A, 7kyj:A
6	8q6u:B	166	77	0.1209	0.1325	0.2857	0.004	8q6u:A
7	3fbu:A	166	106	0.1374	0.1506	0.2358	0.085
8	2bue:A	179	56	0.0824	0.0838	0.2679	0.088	2prb:A, 2qir:A, 1v0c:A, 2vqy:A
9	6oiw:A	504	51	0.0879	0.0317	0.3137	2.1	6oi7:A, 6oi7:B, 6oi7:C, 6oi7:D, 6oi7:E, 6oi7:F, 6oiv:A, 6oiv:B, 6oiv:C, 6oiv:D, 6oiv:E, 6oiv:F, 6oiw:B, 6oiw:C, 6oiw:D, 6oiw:E, 6oiw:F, 6oiy:A, 6oiy:B, 6oiy:C, 6oiy:D, 6oiy:E, 6oiy:F, 4x9e:A, 4x9e:B
10	3h8i:A	356	28	0.0604	0.0309	0.3929	4.4	3h8i:B, 3h8l:A, 3h8l:B
11	2ge3:A	164	63	0.1099	0.1220	0.3175	5.3	2ge3:B, 2ge3:C
12	6sga:F2	915	41	0.0824	0.0164	0.3659	7.5	7pua:F2, 6sgb:F2
13	2mbz:A	143	82	0.1044	0.1329	0.2317	7.7	2mc0:A
14	6riw:A	923	29	0.0659	0.0130	0.4138	9.1

[Back]