PHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKY
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4s2q:D | 76 | 72 | 1.0000 | 0.9474 | 1.0000 | 2.00e-49 | 4euw:A |
2 | 4y60:C | 76 | 70 | 0.6944 | 0.6579 | 0.7143 | 1.35e-32 | |
3 | 6l6y:D | 80 | 70 | 0.6806 | 0.6125 | 0.7000 | 3.54e-32 | 4a3n:A, 3f27:D, 6l6y:F |
4 | 6t78:A | 77 | 71 | 0.6250 | 0.5844 | 0.6338 | 1.82e-31 | 6t78:B, 3u2b:C |
5 | 1gt0:D | 79 | 70 | 0.6250 | 0.5696 | 0.6429 | 4.69e-31 | 8bx1:E, 8bx2:E, 6ht5:D, 1o4x:B, 6t90:L, 6yov:L |
6 | 2gzk:A | 159 | 70 | 0.5000 | 0.2264 | 0.5143 | 1.94e-22 | 9bvd:C, 9bvd:F, 9bvd:I, 6cil:N, 6edb:B, 1hry:A, 1hrz:A, 1j46:A, 1j47:A, 6oem:N, 6oem:H, 6oen:N, 6oen:H, 6oeo:N, 6oer:H |
7 | 2gzk:A | 159 | 68 | 0.2778 | 0.1258 | 0.2941 | 9.13e-05 | 9bvd:C, 9bvd:F, 9bvd:I, 6cil:N, 6edb:B, 1hry:A, 1hrz:A, 1j46:A, 1j47:A, 6oem:N, 6oem:H, 6oen:N, 6oen:H, 6oeo:N, 6oer:H |
8 | 7m5w:A | 138 | 71 | 0.3611 | 0.1884 | 0.3662 | 5.17e-11 | 6jrp:A, 6jrp:D, 6jrp:G, 6jrp:J |
9 | 2lef:A | 86 | 69 | 0.2639 | 0.2209 | 0.2754 | 3.84e-06 | |
10 | 1e7j:A | 74 | 43 | 0.2083 | 0.2027 | 0.3488 | 7.02e-06 | 3nm9:D, 3nm9:G, 3nm9:J, 3nm9:P, 3nm9:M, 3nm9:A, 1qrv:A, 1qrv:B, 8r1x:A |
11 | 5jh0:D | 157 | 62 | 0.2639 | 0.1210 | 0.3065 | 3.91e-05 | 5jgh:A, 5jgh:D, 5jgh:G, 5jgh:J, 5jh0:A |
12 | 5jh0:D | 157 | 52 | 0.2083 | 0.0955 | 0.2885 | 0.002 | 5jgh:A, 5jgh:D, 5jgh:G, 5jgh:J, 5jh0:A |
13 | 6cik:N | 90 | 63 | 0.2639 | 0.2111 | 0.3016 | 5.08e-05 | 6cg0:N, 6cim:N |
14 | 6cij:N | 133 | 63 | 0.2778 | 0.1504 | 0.3175 | 2.66e-04 | 5zdz:N, 5ze1:N, 5ze2:N |
15 | 1j5n:A | 93 | 54 | 0.2222 | 0.1720 | 0.2963 | 4.09e-04 | |
16 | 6bnn:A | 282 | 21 | 0.1528 | 0.0390 | 0.5238 | 1.1 | 6bnx:A, 6bnz:A, 5d7z:A |
17 | 8w06:B | 251 | 54 | 0.2222 | 0.0637 | 0.2963 | 1.4 | 8v09:A, 8v0a:B, 8w06:A, 8w06:C, 8w06:D, 8w06:E, 8w06:F, 8w06:G, 8w06:H |
18 | 6nee:B | 252 | 36 | 0.1806 | 0.0516 | 0.3611 | 1.7 | 6nee:A |
19 | 2w4l:E | 162 | 27 | 0.1389 | 0.0617 | 0.3704 | 4.0 | 2w4l:A, 2w4l:B, 2w4l:D, 2w4l:F |
20 | 4ayx:A | 571 | 27 | 0.1806 | 0.0228 | 0.4815 | 6.0 | 4ayt:A, 4ayw:A, 7y48:B, 3zdq:A |
21 | 4pdd:A | 303 | 39 | 0.1389 | 0.0330 | 0.2564 | 6.6 | 4pdd:B, 4pdd:C |