PHRLVVPFFKIEPSPEESRSNIKGLLQHLRTMVSSMHYKLDEVLWEYNKFESAVTLAEGEGSGALLLIQKYGVKKLFLNT
LATEHSIESEVISGYTTPRMLLPIMPKTHRGELEVILNNSASQITDITHRDWFSNQKNRIPNDADIITMDAETTENLDRS
RLYEAVYTIICNHINPKTLKVVILKVFLSDLDGMCWINNYLAPMFGSGYLIKPITSSAKSSEWYLCLSNLLSTLRTTQHQ
TQANCLHVVQCALQQQVQRGSYWLHHLT
The query sequence (length=268) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6yu8:A | 268 | 268 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6k32:A | 1208 | 72 | 0.0858 | 0.0190 | 0.3194 | 0.34 | 3jb7:A, 6ty9:A, 6tz1:A, 6tz2:A |
3 | 3jb6:A | 1196 | 72 | 0.0858 | 0.0192 | 0.3194 | 0.35 | 5h0r:F, 6ty8:A |
4 | 6ueb:A | 2099 | 139 | 0.1306 | 0.0167 | 0.2518 | 1.6 | |
5 | 5z9s:A | 765 | 84 | 0.0933 | 0.0327 | 0.2976 | 3.5 | 5z9s:B |
6 | 8hyj:A | 1141 | 114 | 0.1157 | 0.0272 | 0.2719 | 3.5 | |
7 | 2x2t:A | 152 | 104 | 0.1082 | 0.1908 | 0.2788 | 3.6 | |
8 | 8g04:B | 398 | 55 | 0.0560 | 0.0377 | 0.2727 | 4.7 | 8g04:C |
9 | 8jxu:A | 1410 | 84 | 0.1007 | 0.0191 | 0.3214 | 5.8 | 8jxq:A |
10 | 4h6z:A | 147 | 45 | 0.0672 | 0.1224 | 0.4000 | 7.4 | 4h6z:B |