PHLHQPSRDLFARRGERLLQLAEGHPMGDYLRLVAGLCRLQQALLDNPPALAPLDPERLRKSREHGMPPLAYDLLVREGA
WLPWLDALLAGYPAPANAAVGAALEQLREAEEGQRKAWAIALLSGQFDLLPAALVPFLGAALQVAWSHWLLGLEEGAVVE
TESRTLCPACGSPPMAGMIRQTGLRYLSCSLCACEWHYVRIKCSHCEESKHLAYLSLEHGQPAEKAVLRAETCPSCQGYL
KQFYLEFDRHADALADDLASLALDMRLAEDGYLRRSPNLLLAPGG
The query sequence (length=285) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2fiy:A | 285 | 285 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2fiy:B |
| 2 | 2d74:B | 137 | 31 | 0.0386 | 0.0803 | 0.3548 | 0.61 | 2dcu:B |
| 3 | 3uar:A | 203 | 62 | 0.0737 | 0.1034 | 0.3387 | 3.1 | |
| 4 | 6o7g:B | 60 | 40 | 0.0526 | 0.2500 | 0.3750 | 4.6 | 8u2y:B |
| 5 | 8tfo:A | 390 | 37 | 0.0421 | 0.0308 | 0.3243 | 9.2 | 8tfo:B |
umich.edu