BioLiP

>protein
PGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHES
LVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDPFNVDDVLKFTFTGEK

The query sequence (length=159) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3j1o:J	159	159	1.0000	1.0000	1.0000	8.14e-117	3rj1:J, 3rj1:Q, 7ui9:h, 7uif:h, 7uig:h, 7uio:Ah, 7uio:Bh
2	5iji:A	227	55	0.1132	0.0793	0.3273	0.15	5jef:A, 5jef:B, 5jgp:A
3	5fjm:A	447	67	0.1258	0.0447	0.2985	0.19	5fjm:B, 5fjn:A, 5fjn:B
4	7ns4:i	358	163	0.2201	0.0978	0.2147	0.96
5	4g6u:A	213	60	0.1006	0.0751	0.2667	1.7
6	7ajt:UR	482	58	0.0943	0.0311	0.2586	3.3	7aju:UR, 7d4i:B8, 7d5s:B8, 7d5t:B8, 7d63:B8, 6ke6:B8, 6lqp:B8, 6lqq:B8, 6lqr:B8, 6lqs:B8, 6lqt:B8, 6lqu:B8, 6lqv:B8, 6nd4:S, 7suk:LS, 5wlc:LS, 6zqa:UR, 6zqb:UR, 6zqc:UR, 6zqd:UR
7	3w9z:A	290	88	0.1006	0.0552	0.1818	4.4
8	5ccv:A	849	75	0.1509	0.0283	0.3200	4.6	6h80:A, 6h9r:A, 6izz:A
9	3dnf:B	282	65	0.1195	0.0674	0.2923	5.0	3dnf:A
10	5d4w:A	688	34	0.0943	0.0218	0.4412	5.2	5d4w:B, 5d4w:C, 5zui:A
11	7bzc:A	535	92	0.1384	0.0411	0.2391	5.2	7bzb:A
12	5zcr:A	725	87	0.1384	0.0303	0.2529	6.3	5zcr:B
13	6zu5:SBB	80	33	0.0881	0.1750	0.4242	7.2
14	7d6v:A	601	58	0.1132	0.0300	0.3103	7.6	7d6x:A

[Back]