BioLiP

>protein
PGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLR
SRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTD
SFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMK
SEDYLSSISETI

The query sequence (length=252) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3w68:C	252	252	1.0000	1.0000	1.0000	0.0
2	1oiz:A	265	248	0.8968	0.8528	0.9113	7.24e-166	5mue:A, 5mug:A, 1oip:A, 1oiz:B, 1r5l:A, 3w67:A, 3w67:B, 3w67:C, 3w67:D, 3w68:A, 3w68:B, 3w68:D, 6zpd:A
3	4ciz:A	284	209	0.2659	0.2359	0.3206	7.02e-39	4cj6:A, 3hx3:A, 3hy5:A
4	1olm:E	397	235	0.2778	0.1763	0.2979	1.06e-21	1olm:A, 1olm:C, 4omj:A, 4omj:B, 4omk:A, 4omk:B
5	4tlg:A	396	239	0.2698	0.1717	0.2845	9.20e-21	4tlg:B
6	6f0e:A	300	245	0.2619	0.2200	0.2694	1.50e-16	7zg9:A, 7zg9:B, 7zga:A, 7zgb:A, 7zgc:A, 7zgd:A
7	3b7n:A	307	229	0.2302	0.1889	0.2533	3.69e-12	3b7z:A, 6sld:A
8	7y10:A	291	221	0.2222	0.1924	0.2534	2.42e-09	7y10:B, 7y11:A, 7y11:B
9	6w32:B	288	211	0.1587	0.1389	0.1896	0.003	6w32:A, 6w32:C
10	7wvt:A	364	215	0.1746	0.1209	0.2047	0.24	7wwd:A, 7wwg:A
11	7pkt:r	158	38	0.0595	0.0949	0.3947	6.6
12	1xhf:B	122	27	0.0476	0.0984	0.4444	9.2	1xhf:A

[Back]