PFTEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNDAKFVLHAKQNGIIRR
GHNWVFKADSYESMMSWFDNLKILTST
The query sequence (length=107) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4a6f:B | 110 | 113 | 0.9439 | 0.9182 | 0.8938 | 1.76e-67 | 4a6f:A, 4a6h:A, 4a6h:C, 4a6h:B, 4a6h:D, 4a6k:A, 4a6k:C, 4a6k:B, 4a6k:D |
2 | 9c1w:A | 388 | 106 | 0.2243 | 0.0619 | 0.2264 | 5.20e-04 | 8q61:A |
3 | 6hhg:A | 386 | 94 | 0.1776 | 0.0492 | 0.2021 | 0.018 | 4ejn:A, 6hhf:A, 6hhh:A, 7nh4:A, 7nh5:A, 3o96:A, 6s9x:A |
4 | 6s9w:A | 411 | 97 | 0.1776 | 0.0462 | 0.1959 | 0.23 | 6buu:A, 6buu:B, 6ccy:A, 3cqu:A, 3cqw:A, 4ekk:A, 4ekk:B, 4ekl:A, 4gv1:A, 1h10:A, 6hhi:A, 6hhj:A, 3mv5:A, 3mvh:A, 6npz:A, 6npz:B, 3ocb:A, 3ocb:B, 3ow4:A, 3ow4:B, 3qkk:A, 3qkl:A, 3qkm:A, 1unq:A, 2uvm:A, 8uvy:A, 8uw2:A, 8uw7:A, 8uw9:A, 2uzs:A |
5 | 5u77:A | 117 | 50 | 0.1589 | 0.1453 | 0.3400 | 0.34 | |
6 | 6bbp:A | 520 | 114 | 0.2150 | 0.0442 | 0.2018 | 0.51 | 2a5d:A, 2a5f:A, 2a5g:A, 6bbq:A, 1e0s:A, 1fgy:A, 1fhw:A, 1fhw:B, 1fhx:A, 1fhx:B, 4fme:C, 4fme:F, 2j5x:A, 2j5x:B, 4kax:A, 4kax:B, 3n5c:A, 3n5c:B, 3pcr:B, 2r09:A, 2r09:B, 2r0d:A, 2r0d:B, 3vhx:A, 3vhx:C, 3vhx:E, 3vhx:G, 2w83:A, 2w83:B, 2w83:E, 7xrd:A, 7xrd:B, 7xrd:C, 7xrd:D |
7 | 6u3e:A | 397 | 114 | 0.2150 | 0.0579 | 0.2018 | 0.67 | 6u3e:B, 6u3g:A, 6u3g:B |
8 | 3aj4:A | 112 | 101 | 0.2150 | 0.2054 | 0.2277 | 7.1 | |
9 | 6qwo:B | 253 | 30 | 0.1028 | 0.0435 | 0.3667 | 9.1 | 6qwo:A |