PFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLQDFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEH
IEWFRNYFNEKRVILKESGIQLN
The query sequence (length=103) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gaw:Ah | 120 | 103 | 1.0000 | 0.8583 | 1.0000 | 1.90e-74 | 6gaz:Ah, 7nql:Ah, 7nsi:Ah, 7nsj:Ah, 6ydp:Ah, 6ydw:Ah |
2 | 8ois:AY | 149 | 103 | 0.9029 | 0.6242 | 0.9029 | 2.74e-67 | 5aj4:Ah, 3jd5:h |
3 | 3cb3:A | 373 | 69 | 0.1748 | 0.0483 | 0.2609 | 0.87 | 3cb3:B, 3cb3:C, 3cb3:D, 2og9:A, 2og9:B |
4 | 7nyx:E | 212 | 38 | 0.1262 | 0.0613 | 0.3421 | 1.1 | 7nyw:F, 7nyx:F, 7nyz:E, 7nyz:F, 7nz0:E, 7nz0:F, 7nz2:F3, 7nz2:F4, 7nz2:E3, 7nz2:E4, 7nz2:E1, 7nz2:E2, 7nz2:F1, 7nz2:F2, 7nz3:E1, 7nz3:F1, 7nz3:E2, 7nz3:F2 |
5 | 7jm7:A | 683 | 42 | 0.1359 | 0.0205 | 0.3333 | 1.8 | 7cq5:C, 7cq5:D, 7cq7:C, 7cq7:D, 7jm7:C |
6 | 7jm6:A | 667 | 42 | 0.1359 | 0.0210 | 0.3333 | 2.3 | 7jm6:B |
7 | 3msu:B | 426 | 50 | 0.1650 | 0.0399 | 0.3400 | 3.5 | 3msu:A |