BioLiP

>protein
PFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEFDDFEECLLRYKTMRRMHDIKK
QREKLMKEGKYTPPPHHSGREEPRP

The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ibf:e	105	105	1.0000	1.0000	1.0000	7.55e-76	8iaq:e, 8ib6:e, 8ibb:e, 8ic4:e
2	7v2e:h	105	105	0.7333	0.7333	0.7333	3.49e-55	7v2h:h, 7v2r:h, 7v30:h, 7v33:h, 7vbl:h, 7vbp:h, 7vc0:h, 7vy9:h, 7vys:h, 7vz8:h, 7w00:h, 7w0r:h, 7w0y:h, 7w2k:h, 7w2r:h, 7w2u:h, 7w2y:h, 7w4c:h, 7w4e:h, 7w4f:h, 7w4j:h, 7w4k:h
3	5xtc:h	104	104	0.7333	0.7404	0.7404	3.00e-54	5xtd:h, 5xth:h, 5xti:h, 5xti:Bh
4	6kut:A	688	88	0.2190	0.0334	0.2614	0.47	6kuj:A, 6kuk:A, 6kup:A, 6kur:A, 6kuu:A, 6kuv:A
5	6x89:S5	66	60	0.1524	0.2424	0.2667	0.48
6	4j8f:A	551	63	0.1619	0.0309	0.2698	0.83	5aqw:A, 5aqx:A, 5aqy:A, 5aqz:A, 5ar0:A, 3atu:A, 3atv:A, 3ay9:A, 5bn8:A, 5bn9:A, 5bpl:A, 5bpm:A, 3d2f:B, 3d2f:D, 2e88:A, 2e8a:A, 7f4x:A, 7f4z:A, 7f50:A, 7fgm:A, 6fhk:A, 6fhk:B, 6g3r:A, 6g3s:A, 3gdq:A, 1hjo:A, 4io8:A, 3jxu:A, 7kw7:D, 5mkr:A, 5mks:A, 7q4r:A, 1s3x:A, 1xqs:C, 1xqs:D, 6zyi:A
7	3afl:A	766	32	0.0952	0.0131	0.3125	5.0
8	7jm6:A	667	53	0.1143	0.0180	0.2264	5.5	7jm6:B
9	8x5f:A	616	45	0.1429	0.0244	0.3333	6.7	8x5b:F, 8x5b:A, 8x5f:B
10	7ut1:b	244	45	0.1619	0.0697	0.3778	8.0	7usf:D, 7usf:C, 7ut1:g, 7ut1:h, 7ut1:H, 7ut1:f, 7ut1:B, 7ut1:F, 7ut1:G

[Back]