BioLiP

>protein
PFFDVQKRLGLDLDRWMTIQSAEQPHKIPGRCHAFEKEWIECAHGIGGIRAEKECKIEFDDFVECLLRQKTMKRLSAIKR
QRDKLIKEGKYTPPPHHLGKEDPRP

The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7v2e:h	105	105	1.0000	1.0000	1.0000	4.62e-75	7v2h:h, 7v2r:h, 7v30:h, 7v33:h, 7vbl:h, 7vbp:h, 7vc0:h, 7vy9:h, 7vys:h, 7vz8:h, 7w00:h, 7w0r:h, 7w0y:h, 7w2k:h, 7w2r:h, 7w2u:h, 7w2y:h, 7w4c:h, 7w4e:h, 7w4f:h, 7w4j:h, 7w4k:h
2	5xtc:h	104	104	0.7810	0.7885	0.7885	2.16e-61	5xtd:h, 5xth:h, 5xti:h, 5xti:Bh
3	8ibf:e	105	105	0.7333	0.7333	0.7333	3.49e-55	8iaq:e, 8ib6:e, 8ibb:e, 8ic4:e
4	6x89:S5	66	58	0.1524	0.2424	0.2759	0.044
5	4j8f:A	551	74	0.2000	0.0381	0.2838	0.099	5aqw:A, 5aqx:A, 5aqy:A, 5aqz:A, 5ar0:A, 3atu:A, 3atv:A, 3ay9:A, 5bn8:A, 5bn9:A, 5bpl:A, 5bpm:A, 3d2f:B, 3d2f:D, 2e88:A, 2e8a:A, 7f4x:A, 7f4z:A, 7f50:A, 7fgm:A, 6fhk:A, 6fhk:B, 6g3r:A, 6g3s:A, 3gdq:A, 1hjo:A, 4io8:A, 3jxu:A, 7kw7:D, 5mkr:A, 5mks:A, 7q4r:A, 1s3x:A, 1xqs:C, 1xqs:D, 6zyi:A
6	3bow:B	174	68	0.2000	0.1207	0.3088	0.82	1alv:A, 1alv:B, 1alw:A, 1alw:B, 5d69:A, 5d69:B, 3df0:B, 1dvi:A, 1dvi:B, 1np8:A, 1np8:B, 1nx0:A, 1nx0:B, 1nx1:A, 1nx1:B, 1nx2:A, 1nx3:A, 4phj:A, 4phj:B, 4phk:A, 4phk:B, 4phm:A, 4phm:B, 4phn:A, 4phn:B, 6qlb:A, 6qlb:B, 6qlb:C, 6qlb:D, 4wq2:A, 4wq2:B, 4wq3:A, 4wq3:B
7	4okh:A	171	77	0.2000	0.1228	0.2727	1.3	4okh:B, 4okh:C
8	8f9x:A	230	76	0.2381	0.1087	0.3289	1.8	8f9x:B, 8f9x:C, 8f9x:D, 8f9x:E, 8f9x:F, 8f9x:G, 8f9x:H, 8f9x:I, 8f9x:J
9	3bow:A	680	72	0.1905	0.0294	0.2778	2.9	3df0:A, 1mdw:A, 1mdw:B
10	3ki9:A	467	35	0.1238	0.0278	0.3714	7.0
11	6sg9:FF	408	30	0.1143	0.0294	0.4000	9.1	6sgb:FF
12	8x5f:A	616	45	0.1333	0.0227	0.3111	9.3	8x5b:F, 8x5b:A, 8x5f:B

[Back]