PEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNEEEFAYVDPARRQILFKYPMYMQLEEELMKLDIF
KIVQSRLMSTSYHLNSTLESLYD
The query sequence (length=103) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3rj1:G | 103 | 103 | 1.0000 | 1.0000 | 1.0000 | 1.49e-73 | 3rj1:N, 3rj1:U |
2 | 4gwq:G | 170 | 78 | 0.7282 | 0.4412 | 0.9615 | 1.41e-49 | 5sva:M, 7ui9:f, 7uif:f, 7uig:f, 7uio:Af, 7uio:Bf |
3 | 4gwq:G | 170 | 25 | 0.2427 | 0.1471 | 1.0000 | 9.50e-10 | 5sva:M, 7ui9:f, 7uif:f, 7uig:f, 7uio:Af, 7uio:Bf |
4 | 8t9d:C | 178 | 37 | 0.1942 | 0.1124 | 0.5405 | 2.85e-06 | 8t1l:C |
5 | 4xx6:B | 321 | 45 | 0.1456 | 0.0467 | 0.3333 | 1.1 | 4xx6:A |
6 | 8fs6:G | 298 | 41 | 0.1456 | 0.0503 | 0.3659 | 1.9 | |
7 | 7pnb:A | 183 | 63 | 0.1650 | 0.0929 | 0.2698 | 2.2 | 7pnb:C, 7pnb:E, 7pnb:D, 7pnb:F, 7pnb:G, 7pnb:H, 7pnb:I, 8rzl:C, 8rzl:E, 8rzl:A, 8rzl:B, 8rzl:D |
8 | 7w16:A | 264 | 84 | 0.1942 | 0.0758 | 0.2381 | 4.9 | |
9 | 7w81:A | 181 | 21 | 0.0971 | 0.0552 | 0.4762 | 6.0 | 3qug:A, 3qug:B, 3quh:A, 3quh:B, 3vtm:A, 3vtm:B, 7w81:B, 2z6f:A |
10 | 1g6h:A | 254 | 20 | 0.0971 | 0.0394 | 0.5000 | 9.2 | 1g9x:A, 1g9x:B, 1g9x:C |