PELMWAPSLRNSLRVSPEALELAEREAERARSERWDRCAQVLKNRLLRVELDGIMRDHLARAEEIRQD
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7bqx:G | 84 | 68 | 1.0000 | 0.8095 | 1.0000 | 2.21e-42 | 7bqx:K, 7br7:K, 7br7:G |
2 | 8odw:A | 612 | 52 | 0.2500 | 0.0278 | 0.3269 | 2.4 | 8odw:B |
3 | 1uoz:A | 300 | 46 | 0.2206 | 0.0500 | 0.3261 | 7.0 | 1up0:A, 1up2:A, 1up3:A |
4 | 7w7g:A | 1528 | 37 | 0.1324 | 0.0059 | 0.2432 | 9.5 |