PEEERIKYVITVVEQIAKDAHRNGQEELAKLAERTAEEAKKATERGEEETLRIVYVIVVVLQIALEAHRNGQEELAKLAL
RTAEEAIKATERGEEETLRIVYVIVVVLQIALEAHRNGQEELAKLALRTAEEAIKATERGEEETLRIVYVIVVVLQIALE
AHRNGQEELAKLALRTAEEAIKATERGEEETLRIVYVIVVVLQIALEAHRNGQEELAKLALRTAEEAIKATERGEEETER
IVYDIVVVLQEALEAHRNGEEERAKKALDEARRRIEATERG
The query sequence (length=281) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7udm:B | 281 | 281 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7udl:A, 7udm:A |
| 2 | 7udj:H | 192 | 179 | 0.2954 | 0.4323 | 0.4637 | 3.70e-22 | |
| 3 | 7udj:H | 192 | 177 | 0.2847 | 0.4167 | 0.4520 | 7.31e-20 | |
| 4 | 7udj:H | 192 | 172 | 0.2740 | 0.4010 | 0.4477 | 7.94e-20 | |
| 5 | 7udj:H | 192 | 133 | 0.2206 | 0.3229 | 0.4662 | 1.37e-12 |
umich.edu