PDVDRFGRLPWLWITVLVFVLDQVSKAFFQAELSMYQQIVVIPDLFSWTLAYNTGAAFSGWQRWLFALIAIVVSASLVVW
LKRLKKGETWLAIALALVLGGALGNLYDRMVLGHVVDFILVHWQNRWYFPAFNLADSAITVGAVMLALD
The query sequence (length=149) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5dir:A | 157 | 155 | 1.0000 | 0.9490 | 0.9613 | 6.76e-102 | 5dir:C, 5dir:D, 5dir:B, 6fms:A, 6fms:B, 6fms:C, 6fms:D |
2 | 6ryp:A | 164 | 138 | 0.3087 | 0.2805 | 0.3333 | 6.04e-15 | 6ryo:A |
3 | 4uwq:A | 548 | 86 | 0.1409 | 0.0383 | 0.2442 | 4.1 | 4uwq:D, 4uwq:G, 4uwq:J, 2wdc:A, 2wdd:A, 2wde:A, 2wdf:A |
4 | 5f1c:B | 355 | 44 | 0.0738 | 0.0310 | 0.2500 | 7.2 | 5f1c:A, 5f1c:C |
5 | 7c79:B | 793 | 68 | 0.1141 | 0.0214 | 0.2500 | 8.2 | 6agb:B, 6ah3:B, 7c7a:B, 6w6v:B |