PDEINKLIETGLNTVEYFTSQQVTGTSSLGKNTIPPGVTGLLTNAPKIAIVPADDKTVPGKPIPNPLLGLDSTPSTQTVL
DLSGKTLPSGSYKGVKLAKFGKENLMTRFIEEPRENPDFKRGRDTGGFHRREYSIGWVGDEVKVTEWCNPSCSPITAAAR
RFECTCHQCPVTCSECERDT
The query sequence (length=180) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2hye:B | 180 | 180 | 1.0000 | 1.0000 | 1.0000 | 2.53e-133 | 2b5l:C, 2b5l:D, 4i1s:B |
| 2 | 5h29:A | 207 | 118 | 0.1333 | 0.1159 | 0.2034 | 6.0 |
umich.edu