BioLiP

>protein
PDARRQAQLRHLLLQDCGSCHGLRLTLGPALTPEALRGKPRESLVATVLMGRPQTPMPPWAGLLSADDAGWLVDRLIEG

The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6tp9:A	85	81	1.0000	0.9294	0.9753	7.02e-50	6tp9:C, 6tp9:B, 6tp9:F, 6tp9:D, 6tp9:J, 6tp9:E, 6tp9:K, 6tp9:G, 6tp9:H, 6tp9:I
2	6rtd:B	466	54	0.3165	0.0536	0.4630	0.015	6rtd:A, 6rte:A, 6rte:B
3	7fgp:A	379	53	0.2152	0.0449	0.3208	0.34	7fgp:B
4	2yev:B	319	47	0.1772	0.0439	0.2979	0.68	2yev:E
5	2vhd:A	323	52	0.2152	0.0526	0.3269	1.8	1eb7:A, 2vhd:B
6	3tvi:E	439	47	0.1772	0.0319	0.2979	3.3	3tvi:A, 3tvi:B, 3tvi:C, 3tvi:D, 3tvi:G, 3tvi:H, 3tvi:I, 3tvi:L
7	7os0:A	1130	57	0.2405	0.0168	0.3333	3.4	7os0:C
8	6kls:C	236	16	0.1013	0.0339	0.5000	4.0	6kls:F, 6klv:C, 6klv:F
9	1duw:A	289	51	0.1899	0.0519	0.2941	5.0
10	8dil:A	175	29	0.1266	0.0571	0.3448	5.3	8dil:B, 8dil:C, 8dil:D, 8dil:E, 8dil:F
11	5li0:4	56	22	0.1013	0.1429	0.3636	7.5	7asm:Z, 7asn:b, 7aso:g, 7asp:Z, 6ddd:N, 6ddg:N, 6fxc:AZ, 6fxc:BZ, 5hkv:Z, 5hl7:Z, 6hma:Z, 5nd8:4, 5nd9:4, 5ngm:AZ, 7nhl:5, 7nhm:5, 5nrg:Z, 8p2f:5, 8p2g:5, 8p2h:5, 7p48:Z, 6s0x:Z, 6s0z:Z, 6s12:Z, 6s13:Z, 5t7v:LE, 5tcu:LE, 7ttu:N, 7ttw:N, 4wce:Z, 4wf9:Z, 4wfa:Z, 4wfb:Z, 6wqn:N, 6wqq:N, 6wrs:N, 6wru:N, 8y36:Z, 8y37:Z, 8y38:Z, 8y39:Z, 6yef:4
12	7mii:A	497	15	0.1139	0.0181	0.6000	8.3	7mih:A, 7mih:B, 7mih:C, 7mih:E, 7mii:B, 7mii:C, 7mii:E
13	6pk4:A	559	15	0.1139	0.0161	0.6000	8.7	7mh1:H, 7mh1:J, 7mh1:K, 7mh1:L, 7miu:D, 7miu:C, 7miu:H, 7miu:G, 7miv:D, 7miv:C, 7miv:H, 7miv:G, 6pk4:B, 6pk4:C, 6pk4:D, 6pk7:A, 6pk7:D, 6pk7:E, 6pk7:F
14	3va4:B	108	30	0.1266	0.0926	0.3333	8.8
15	6v59:A	419	22	0.1266	0.0239	0.4545	9.4	6nx0:A, 6v59:B

[Back]