PCPPTNAERLHEFHRAIGAATPERPTPPPPELLRLRQTLLDEASAEVRAEIDHLLARQAAGEALSAGDLAPLAHELADLL
YVTYGALDQLGIDADAVFAEVHRANLSKASGLKPEGWRPADVRGVIERLQHA
The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yf3:C | 153 | 140 | 0.9924 | 0.8562 | 0.9357 | 1.49e-87 | 5hva:A, 5hva:B, 5hva:C, 5hva:D, 5hwu:A, 5hwu:B, 5hx1:A, 5hx1:C, 5hx1:B, 5hx1:D, 5hyl:A, 5hyl:C, 5hyl:B, 5hyl:D, 5hzz:A, 5hzz:B, 5hzz:C, 5hzz:D, 5i0j:A, 5i0j:D, 5i0j:B, 5i0j:C, 5i0m:A, 5i0m:D, 5i0m:B, 5i0m:C, 2yf3:A, 2yf3:B, 2yf3:D, 2yf3:E, 2yf3:F, 2yfc:A, 2yfc:B, 2yfc:C, 2yfc:D, 2yfd:A, 2yfd:B, 2yfd:C, 2yfd:D |
2 | 4df2:A | 404 | 76 | 0.1818 | 0.0594 | 0.3158 | 0.50 | 4m5p:A, 4qai:A, 4qai:B, 4qai:C, 4qai:D, 4qai:E, 4qai:F, 3tjl:A, 3upw:A |
3 | 2yxh:A | 114 | 82 | 0.1742 | 0.2018 | 0.2805 | 5.0 | 2yxh:B |
4 | 3tqo:A | 387 | 51 | 0.1439 | 0.0491 | 0.3725 | 5.5 | |
5 | 8snd:A | 500 | 33 | 0.0909 | 0.0240 | 0.3636 | 7.5 | 8snc:A, 8sne:A, 7sp6:A, 7sp7:A, 7sp8:A, 7sp9:A, 7spa:A |
6 | 5fp1:A | 701 | 62 | 0.1212 | 0.0228 | 0.2581 | 7.8 | |
7 | 1cgm:E | 160 | 48 | 0.1288 | 0.1062 | 0.3542 | 8.1 | |
8 | 8han:K | 500 | 92 | 0.1818 | 0.0480 | 0.2609 | 8.4 | 4n4f:A |
9 | 8ham:K | 517 | 98 | 0.1818 | 0.0464 | 0.2449 | 9.7 | 6alb:A, 8hal:K |