BioLiP

>protein
PCDCDVGGALDPQCDEATGQCRCRPHMIGRRCEQVQPGYFRPFLDHLTWEAEGAHGQVLEVVERLVTNRETPSWTGVGFV
RLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELVVQRPGPVSAHSPCGHVLPRDDRIQGMLHPNTRVLVFPRP
VCLEPGLSYKLKLKLTGTGGRGSGILIDSLVLQPHVLMLEMFSGGDAAALERRTTFERYRCHEEGLMPSKTPLSEACVPL
LISASSLVYNGALPCQCDPQGSLSSECNPHGGQCRCKPGVVGRRCDACATGYYGFGPAGCQA

The query sequence (length=302) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5lf2:A	302	302	0.9967	0.9967	0.9967	0.0	5lf2:B
2	4wnx:A	429	53	0.0828	0.0583	0.4717	1.06e-06
3	8edk:A	412	59	0.0861	0.0631	0.4407	1.80e-06
4	8edk:A	412	38	0.0464	0.0340	0.3684	0.066
5	4ove:A	422	38	0.0629	0.0450	0.5000	5.58e-04	6fkq:A, 7lrf:A, 7lrf:B, 7ndg:A, 7ndg:G, 7ndg:D, 7ne0:A, 7ne1:A, 4plm:A, 4pln:A, 4pln:B, 4plo:A, 4urt:A
6	4ove:A	422	38	0.0497	0.0355	0.3947	0.27	6fkq:A, 7lrf:A, 7lrf:B, 7ndg:A, 7ndg:G, 7ndg:D, 7ne0:A, 7ne1:A, 4plm:A, 4pln:A, 4pln:B, 4plo:A, 4urt:A
7	8ro1:DX	682	137	0.1126	0.0499	0.2482	0.065
8	3tsd:B	426	83	0.0861	0.0610	0.3133	0.55
9	6az1:Q	115	60	0.0695	0.1826	0.3500	1.3	8ovj:SQ, 8rxh:SQ, 8rxx:SQ
10	7pwd:A	621	98	0.0795	0.0386	0.2449	2.2	6c2y:A, 3cik:A, 5he1:A, 7k7l:A, 3krw:A, 3krx:A, 3pvu:A, 3pvw:A, 5ukk:A, 5wg3:A, 5wg5:A
11	3uzs:A	609	92	0.0795	0.0394	0.2609	2.4	3uzt:A
12	4chg:A	133	32	0.0497	0.1128	0.4688	6.8	4chg:B, 4chg:E, 4chg:D, 4chg:F

[Back]