BioLiP

>protein
PCAYGLLLHPTSLPGPWGVGVLGEEARGFLRFLKEAGARYWQVLPLGPTGYGDSPYQSFSAFAGNPYLIDLRPLVDRGFV
RLEDPGFPEGRVDYGLLYAWKWPALRAAFQGFRQKASPEEKEDFARFQEEEAWWLRDYALFMTLKSHHGGLPWNAWPLAL
RTREERALKEAEASLAEEIAFHAFTQWLFFRQWGALKEEAEALGIAFIGDMPIFVAEDSAEVWAHPEWFHLDEEGRPTVV
AGVPPDYFSETGQRWGNPLYRWEVLEEEGFSFWIARLRKALELFHLVRIDHFRGFEAYWEIPASCPTAVEGRWVKAPGEK
LFARIQEAFGRIPILAEDLGVITPEVEALRDRFGLPGMKVLQFAFDNGMENPFLPHNYPEHGRVVVYTGTHDNDTTLGWY
RTATPHERDFLKRYLADWGITFREEAEVPWALMRLGMASRARLAVYPVQDVLALGSEARMNYPGRPSGNWAWRLRPGEIK
EEHGERLLSLAEATGRV

The query sequence (length=497) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2x1i:A	497	497	1.0000	1.0000	1.0000	0.0
2	1esw:A	500	497	0.8672	0.8620	0.8672	0.0	5jiw:A, 2owc:A, 2oww:A
3	6lx2:A	523	477	0.4205	0.3996	0.4382	2.07e-130	6lx1:A
4	6m6t:C	499	503	0.4064	0.4048	0.4016	1.12e-125	6m6t:A, 6m6t:B, 6m6t:D, 6m6t:E, 6m6t:F, 6m6t:G, 6m6t:H
5	5csu:A	518	500	0.4165	0.3996	0.4140	3.01e-124	5cps:A, 5cps:B, 5cpt:A, 5cpt:B, 5cq1:A, 5cq1:B, 5csu:B, 5csy:A, 5csy:B
6	4s3q:A	682	321	0.1811	0.1320	0.2804	1.50e-22	4s3r:A
7	5b68:A	703	372	0.1851	0.1309	0.2473	2.32e-13
8	6lck:A	479	126	0.0744	0.0772	0.2937	0.30	6lck:B, 6lck:C, 6lcl:A, 6lcl:C, 6lcl:E
9	1odz:A	379	57	0.0362	0.0475	0.3158	7.6	1gvy:A, 1gw1:A, 1j9y:A, 1odz:B, 1r7o:A, 2whm:A
10	8bcj:B	250	28	0.0221	0.0440	0.3929	8.2	8bcj:A, 8bcj:C, 8bcj:D
11	4bxs:V	1262	30	0.0241	0.0095	0.4000	8.2
12	8x43:A	327	60	0.0362	0.0550	0.3000	8.6	8j00:A, 8j00:B, 8j00:C, 8j00:D, 8x43:G, 8x43:C, 8x43:E

[Back]