BioLiP

>protein
PATVAELQAEIAAWIHPLNPDRRPGGTIAKLLEEIGELIASDRDPLEVADVLILALDLATLLGVDVTEAIRAKLAINRAR
SWARADNGAMRHIP

The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ody:C	100	96	1.0000	0.9400	0.9792	8.27e-60	7ody:A, 7ody:B, 7ody:D
2	2q5z:B	94	92	0.2766	0.2766	0.2826	0.098	2q5z:A, 2q73:A, 2q73:B, 2q73:C, 2q73:D, 2q9l:A, 2q9l:B, 2q9l:C, 2q9l:D
3	6sqw:A	114	34	0.1489	0.1228	0.4118	0.23	2oig:B, 2oig:A, 2oig:D, 6sqw:D, 6sqy:A, 6sqy:D, 6sqz:A, 6sqz:D
4	7mu5:A	110	34	0.1596	0.1364	0.4412	0.65	7mu5:E, 7mu5:B, 7mu5:H, 7mu5:C, 7mu5:D, 7mu5:F, 7mu5:G
5	5iit:C	357	62	0.2234	0.0588	0.3387	2.6	3iid:A, 3iif:A, 3iif:B, 3iif:C, 5iit:B
6	7xn7:m	1187	17	0.0957	0.0076	0.5294	5.6	7xse:m, 7xsx:m, 7xsz:m, 7xt7:m, 7xtd:m, 7xti:m
7	6ax9:A	340	58	0.2021	0.0559	0.3276	5.9	6axm:A, 6axn:A, 6axu:A, 3kb9:A, 7kj8:A, 7kj9:A, 7kjd:A, 7kje:A, 7kjf:A, 7kjg:A, 3lg5:A, 4ltz:A, 4luu:A, 4lxw:A, 4lz0:A, 4lz3:A, 4lzc:A, 6ofv:A, 8su1:A, 8su2:A, 8su3:A, 8su4:A, 8su5:A, 8v3k:A
8	6nu8:A	488	39	0.1809	0.0348	0.4359	8.0
9	5kd6:A	400	58	0.2340	0.0550	0.3793	8.0	5kcl:A, 5kcl:B, 5kcq:A, 5kcq:B, 5kcy:A, 5kcy:B, 5kd0:A, 5kd0:B, 5kd6:B, 5kda:A, 5kda:B
10	2xsj:B	385	36	0.1170	0.0286	0.3056	8.5	2xsj:E
11	8ip0:A	212	24	0.0957	0.0425	0.3750	8.7	8h67:A, 8h7q:A
12	6v9s:A	503	24	0.1277	0.0239	0.5000	9.8	4zj8:A, 4zjc:A

[Back]