PAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRDHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNII
QVKKTDFEVFDALMVDSQKHQEPYVCKRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSA
THRYKKKYVTTLLYKPI
The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7myj:D | 187 | 187 | 0.9887 | 0.9358 | 0.9358 | 3.70e-126 | 6b1u:B, 6b1u:D, 8bik:B, 8bik:E, 6c9f:B, 6c9g:B, 6c9j:B, 4cfe:B, 4cfe:D, 4cff:B, 4cff:D, 5ezv:B, 5ezv:D, 5iso:B, 5iso:D, 7myj:B, 4yef:A, 4yef:B, 4yef:C, 4yef:D, 4yef:E, 4yef:F, 4yef:G, 1z0m:A, 1z0m:B, 1z0m:C, 1z0n:A, 1z0n:B, 1z0n:C, 4zhx:B, 4zhx:D |
2 | 6c9h:B | 168 | 177 | 0.9492 | 1.0000 | 0.9492 | 2.33e-122 | 6e4t:B, 6e4u:B, 6e4w:B, 5kq5:B, 4qfr:B, 4qfs:B, 5t5t:B, 5ufu:B |
3 | 6b2e:B | 193 | 178 | 0.8249 | 0.7565 | 0.8202 | 1.79e-105 | 4cfh:B, 4rer:B, 4yee:A, 4yee:G, 4yee:B, 4yee:C, 4yee:D, 4yee:N, 4yee:E, 4yee:F, 4yee:H, 4yee:I, 4yee:J, 4yee:K, 4yee:L, 4yee:M, 4yee:O, 4yee:P, 4yee:Q, 4yee:R |
4 | 2qrd:D | 92 | 57 | 0.1695 | 0.3261 | 0.5263 | 1.31e-14 | 2qr1:B, 2qr1:D, 2qrc:B, 2qrc:D, 2qrd:B |
5 | 4pyh:A | 293 | 73 | 0.1582 | 0.0956 | 0.3836 | 4.58e-08 | |
6 | 8dl1:A | 713 | 51 | 0.1017 | 0.0252 | 0.3529 | 0.068 | 8dge:A, 8dge:B, 8dge:C, 8dge:D, 8dl1:B, 8dl1:C, 8dl1:D, 8dl2:A, 8dl2:B, 8dl2:C, 8dl2:D |
7 | 6xb3:A | 234 | 77 | 0.1356 | 0.1026 | 0.3117 | 0.92 | 6xb3:B, 6xb3:C, 6xb3:D, 6xb3:E, 6xb3:F, 6xb3:G, 6xb3:H, 6xb3:I, 6xb3:J, 6xb3:K, 6xb3:L, 6xb3:M, 6xb3:N, 6xb3:O, 6xb3:P |
8 | 8g6d:B | 253 | 90 | 0.1186 | 0.0830 | 0.2333 | 3.7 | 8g6d:D, 8g6d:F, 8g6d:H, 8g6d:J, 8g6d:L, 4zxs:B, 4zxs:D |
9 | 8umu:A | 515 | 99 | 0.1356 | 0.0466 | 0.2424 | 3.8 | |
10 | 7p43:B | 690 | 44 | 0.0621 | 0.0159 | 0.2500 | 7.4 | 7p43:A |
11 | 5avp:A | 240 | 22 | 0.0565 | 0.0417 | 0.4545 | 9.2 | 5avp:B, 5avp:C, 5avp:D |
12 | 2cdq:A | 470 | 15 | 0.0565 | 0.0213 | 0.6667 | 9.8 | 2cdq:B |
13 | 7esn:A | 435 | 31 | 0.0678 | 0.0276 | 0.3871 | 10.0 | 7esk:A, 7esm:A, 8i4d:A, 7yqs:A |