PAPNNYSLPSILGGRSCVKPSKPVYSMRGRNKMGGFDEDLQKTPGPGSYDVVDPAIYKNKSPMYSITGRNQLPCDSTRKP
GPGQHSPEKVTVNKRMAPKFSFGVPHSQYTTPLIIQS
The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8snb:5N | 244 | 117 | 1.0000 | 0.4795 | 1.0000 | 4.05e-82 | 8snb:5F, 8snb:5G, 8snb:5H, 8snb:5J |
2 | 8snb:5N | 244 | 22 | 0.1026 | 0.0492 | 0.5455 | 0.20 | 8snb:5F, 8snb:5G, 8snb:5H, 8snb:5J |
3 | 8snb:5N | 244 | 102 | 0.2735 | 0.1311 | 0.3137 | 0.22 | 8snb:5F, 8snb:5G, 8snb:5H, 8snb:5J |
4 | 6n9j:B | 356 | 38 | 0.1368 | 0.0449 | 0.4211 | 0.35 | 6n9j:A |
5 | 1to4:A | 156 | 55 | 0.1624 | 0.1218 | 0.3455 | 4.6 | 1to4:B, 1to4:C, 1to4:D, 1to5:A, 1to5:B, 1to5:C, 1to5:D |
6 | 6ea8:A | 195 | 59 | 0.1624 | 0.0974 | 0.3220 | 4.9 | 6ea8:B, 6ea8:E, 6ea8:F, 6ea8:G, 6ea8:H, 6ea9:A, 6ea9:B, 6ea9:C, 6ea9:D, 6ea9:E, 8orv:A, 8p44:A, 8p44:B, 8p44:C, 8p44:D |