PAGRQAGQQATVDRLRTQVTGFLSGALGKLQALSAQNMDPELAQFRVLDVDRAIMPLLIVAENARNPGLNLVPLHMDMAE
DEEVRTQPPMAGSRHIAEFVASARPGRYRAVIDDGSHTRAADIRKDASGTSVIVVDPLRKEKDESAYVDYADNVNMEFGE
HAKCAFIPVDIQKSFFDCRILSLSLALKMHDKDDAFAAFHETLRNGGDPSHHVSRAQQTEELGATLVLDGAPLVDARMMK
HGQAASSVSRYLGNHPEQSTVPVNKRNETLGERTTRHLVKRKVRNETKEITFSNSVEQKRIALLNRAASYVNSAPPPVVM
RMAKLLQDSLLD
The query sequence (length=332) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5w3x:C | 342 | 339 | 0.9789 | 0.9503 | 0.9587 | 0.0 | 5w3t:A, 5w3t:B, 5w3t:C, 5w3t:D, 5w3x:A, 5w3y:A, 5w3y:B, 5w3y:C, 5w3y:D, 5w40:A, 5w40:B, 5w40:C, 5w40:D |
2 | 6be0:A | 266 | 291 | 0.2319 | 0.2895 | 0.2646 | 3.73e-08 | |
3 | 5klq:A | 324 | 294 | 0.2169 | 0.2222 | 0.2449 | 0.004 | 5klp:A, 5klp:B, 5klp:C, 5klq:C, 5klq:B |
4 | 5xbl:A | 1320 | 94 | 0.0693 | 0.0174 | 0.2447 | 1.3 | |
5 | 2yd4:A | 203 | 45 | 0.0512 | 0.0837 | 0.3778 | 1.5 | |
6 | 5z74:A | 441 | 87 | 0.0693 | 0.0522 | 0.2644 | 1.8 | 5z74:B |
7 | 3qhx:A | 377 | 38 | 0.0422 | 0.0371 | 0.3684 | 3.8 | 3qhx:B |
8 | 3ssn:B | 350 | 48 | 0.0542 | 0.0514 | 0.3750 | 4.8 | |
9 | 7kb1:A | 428 | 65 | 0.0602 | 0.0467 | 0.3077 | 7.3 | 7kb1:B, 7kb1:C, 7kb1:D |
10 | 7zkq:T | 351 | 42 | 0.0482 | 0.0456 | 0.3810 | 7.4 |