PADALPKGADSFFRTVISNMEKVYLSRNPTAKTILELVRSYDGDHICYDHFAFRTFGVDGYGIKSLAEFFTDFGYVPREE
LRFPAKKLRALWFSPPTNDGYTGTGVYGPLPRIFISELLVDELSPQSQDIIQKYIRTSGKGNKHATLASTSGELTWEKPI
YSDFQVLSRESEYAAWTLVNGYALNHTTISTHRLISDIRSINKFNKFVEDNGFKLNSEGGILKVSPDGLLQQSSTVADSA
LFTFADGITESIPRSYIEFAERLVLPQFKDLPNDEVNEHHRRDGFEVGNADKIFESTSNDQLTRR
The query sequence (length=305) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6w1k:A | 312 | 304 | 0.9967 | 0.9744 | 1.0000 | 0.0 | 6w1k:B, 6w1k:C, 6w1k:D |
2 | 7npa:A | 618 | 76 | 0.0623 | 0.0307 | 0.2500 | 1.7 | 7npa:B, 7npa:C, 7npa:D, 7npa:E, 7npa:F, 7npa:G, 7npa:H, 7npa:I, 7npa:J, 7npa:K, 7npa:L, 7npa:M, 7npa:N, 7npa:O, 7npa:P |
3 | 2vyn:D | 334 | 91 | 0.0787 | 0.0719 | 0.2637 | 5.3 | 2vyv:D |
4 | 3syq:A | 292 | 26 | 0.0361 | 0.0377 | 0.4231 | 6.3 | |
5 | 8hku:L19E | 144 | 52 | 0.0492 | 0.1042 | 0.2885 | 9.8 | 8hkv:L19E, 8hky:L19E, 8hkz:L19E, 8hl1:L19E, 8hl2:L19E, 8hl3:L19E, 8hl4:L19E, 8hl5:L19E |