BioLiP

>protein
PAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRYFINYRTLVNVVK
YKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARFNEQI
EPIYALLRETEDVNLAYEI

The query sequence (length=179) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6o9l:Q	430	193	1.0000	0.4163	0.9275	1.27e-128	8bvw:W, 8byq:W, 7eg9:U, 7ega:U, 7egb:U, 7egc:U, 7ena:EA, 7enc:EA, 5gpy:A, 8gxq:EA, 8gxs:EA, 5iy6:Q, 5iy8:Q, 5iy9:Q, 5iya:Q, 5iyb:Q, 5iyc:Q, 5iyd:Q, 7lbm:Q, 7nvr:W, 7nvs:W, 7nvt:W, 7nvu:W, 7nvy:W, 7nvz:W, 7nw0:W, 8s51:W, 8s52:W, 8s54:W, 8s55:W, 8s5n:W, 1vd4:A, 8wak:U, 8wal:U, 8wan:U, 8wao:U, 8wap:U, 8waq:U, 8war:U, 8was:U
2	6gym:W	258	183	0.2905	0.2016	0.2842	2.24e-26	5oqj:W, 5oqm:W
3	7o4i:W	312	183	0.2905	0.1667	0.2842	9.99e-26	8cen:W, 8ceo:W, 5fz5:W, 6gyl:W, 7ml0:W, 7ml1:W, 7ml2:W, 7ml4:W, 7o4j:W, 7o4k:W, 7o4l:W, 7o72:W, 7o73:W, 7o75:W, 7zs9:W, 7zsa:W, 7zsb:W
4	5z9s:A	765	47	0.0838	0.0196	0.3191	0.80	5z9s:B
5	1mey:F	84	47	0.0670	0.1429	0.2553	2.2	1mey:C
6	1otw:A	255	39	0.0838	0.0588	0.3846	3.5	3hlx:A, 3hlx:D, 3hml:A, 3hml:B, 3hnh:A, 4ny7:A, 4ny7:B, 1otw:B
7	1pft:A	50	36	0.0670	0.2400	0.3333	4.1
8	6hif:G	531	31	0.0782	0.0264	0.4516	7.3	6hif:I, 6hif:H, 6hif:A, 6hif:C, 6hif:B, 6hif:D, 6hif:F, 6hif:E, 6hif:J, 6hif:L, 6hif:K, 6hif:M, 6hif:O, 6hif:N, 6hif:P, 6hif:R, 6hif:Q, 6hif:S, 6hif:U, 6hif:T, 6hif:V, 6hif:X, 6hif:W
9	6k4y:I	88	26	0.0559	0.1136	0.3846	7.7
10	7o0h:B	523	29	0.0559	0.0191	0.3448	8.2

[Back]