PAAAPGKNFDLSHWKLQLPDANTTEISSANLGLGYTSQYFYTDTDGAMTFWAPTTGGTTANSSYPRSELREMLDPSNSKV
NWGWQGTHTMKLSGKTVQLPSSGKIIVAQINGIMDDGTNAPPLVKAVFQDGQLDMQVKQNSDGTGSDVHNYFTGIKLGDL
YNMEIRVTDGVAYVTMNGDTRSVDFVGKDAGWKNLKYYFKAGNFVQDNTSTGGSAIAKLYSLSVSHSNLEHH
The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2zaa:A | 232 | 232 | 1.0000 | 1.0000 | 1.0000 | 1.24e-174 | 2cws:A, 2zab:A, 2zac:A |
2 | 5xnr:A | 385 | 235 | 0.2888 | 0.1740 | 0.2851 | 4.96e-13 | 7d29:A, 7d2a:A |
3 | 7w12:A | 490 | 77 | 0.1293 | 0.0612 | 0.3896 | 2.06e-08 | |
4 | 7ncz:A | 227 | 243 | 0.2716 | 0.2775 | 0.2593 | 9.34e-05 | 7nm6:A, 7npp:A, 7ny3:A, 7o6h:A, 7oof:A, 7ory:A, 7p25:A, 7p90:A, 7pbf:A |
5 | 8pcx:A | 232 | 240 | 0.2672 | 0.2672 | 0.2583 | 0.002 | 8bjo:A, 8bxz:A, 8p6o:A, 8pc3:A, 8pc8:A, 8pdt:A, 8ped:A, 8qli:A, 8r43:A, 8rbn:A |
6 | 2q1w:A | 300 | 61 | 0.0776 | 0.0600 | 0.2951 | 1.7 | 2q1w:B, 2q1w:C |
7 | 4yo7:A | 287 | 89 | 0.0948 | 0.0767 | 0.2472 | 3.7 | |
8 | 3w15:A | 336 | 56 | 0.0560 | 0.0387 | 0.2321 | 4.2 | |
9 | 6oh9:A | 452 | 22 | 0.0474 | 0.0243 | 0.5000 | 6.2 | 6oha:A |