BioLiP

>protein
NYLFEYAPDVLESFPNKHVNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPDEKMVESKSLKLYLFSFRNHGDFHQDC
MNIIMNDLIELMDPRYIEVWGKFTPRGGISIDPYTNYGKPGTKYEKMAEYRMMNHDLYPETIDNR

The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4f8b:B	145	145	0.9931	0.9931	0.9931	8.08e-108	4f8b:A, 4f8b:C, 4f8b:D, 4f8b:E, 4fgc:A, 4fgc:B, 4fgc:C, 4fgc:D, 4fgc:E, 5udg:A, 5udg:D, 5udg:E
2	3s19:A	261	98	0.2138	0.1188	0.3163	8.78e-12	3bp1:A, 3bp1:B, 3bp1:C, 3bp1:D, 4ghm:A, 4ghm:B, 4iqi:A, 4iqi:B, 3rzp:A, 3rzp:B, 3rzp:C, 3rzp:D, 3s19:B, 3s19:C, 3s19:D, 3uxj:A, 3uxj:B, 3uxj:C, 3uxj:D, 3uxv:A, 3uxv:B, 3uxv:C, 3uxv:D
3	5jyx:B	109	69	0.1034	0.1376	0.2174	0.28	5jyx:A, 5jyx:E, 5jyx:C, 5jyx:J, 5jyx:D, 5jyx:H, 5jyx:F, 5jyx:O, 5jyx:G, 5jyx:L, 5jyx:I, 5jyx:K, 5jyx:M, 5jyx:N
4	1wm9:A	185	65	0.1103	0.0865	0.2462	0.73	1wm9:B, 1wm9:C, 1wm9:D, 1wm9:E, 1wuq:A, 1wuq:B, 1wuq:E, 1wuq:C, 1wuq:D, 1wur:A, 1wur:B, 1wur:E, 1wur:C, 1wur:D
5	4xqk:A	1517	85	0.1724	0.0165	0.2941	1.7	4xqk:B
6	8csq:a	263	54	0.1241	0.0684	0.3333	1.8
7	3ihg:A	535	26	0.0759	0.0206	0.4231	1.9	3ihg:B, 3ihg:C
8	3no3:A	238	92	0.1655	0.1008	0.2609	5.2
9	5f55:A	705	41	0.1103	0.0227	0.3902	8.8	5f54:A, 5f56:A, 6lrd:A

[Back]