NYLFEYAPDVLESFPNKHVNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPDEKMVESKSLKLYLFSFRNHGDFHEDC
MNIIMNDLIELMDPRYIEVWGKFTPRGGISIDPYTNYGKPGTKYEKMAEYRMMNHDLYPETIDNR
The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4f8b:B | 145 | 145 | 1.0000 | 1.0000 | 1.0000 | 4.05e-108 | 4f8b:A, 4f8b:C, 4f8b:D, 4f8b:E, 4fgc:A, 4fgc:B, 4fgc:C, 4fgc:D, 4fgc:E, 5udg:A, 5udg:D, 5udg:E |
| 2 | 3s19:A | 261 | 98 | 0.2207 | 0.1226 | 0.3265 | 2.60e-12 | 3bp1:A, 3bp1:B, 3bp1:C, 3bp1:D, 4ghm:A, 4ghm:B, 4iqi:A, 4iqi:B, 3rzp:A, 3rzp:B, 3rzp:C, 3rzp:D, 3s19:B, 3s19:C, 3s19:D, 3uxj:A, 3uxj:B, 3uxj:C, 3uxj:D, 3uxv:A, 3uxv:B, 3uxv:C, 3uxv:D |
| 3 | 5jyx:B | 109 | 69 | 0.1103 | 0.1468 | 0.2319 | 0.13 | 5jyx:A, 5jyx:E, 5jyx:C, 5jyx:J, 5jyx:D, 5jyx:H, 5jyx:F, 5jyx:O, 5jyx:G, 5jyx:L, 5jyx:I, 5jyx:K, 5jyx:M, 5jyx:N |
| 4 | 1wm9:A | 185 | 65 | 0.1172 | 0.0919 | 0.2615 | 0.25 | 1wm9:B, 1wm9:C, 1wm9:D, 1wm9:E, 1wuq:A, 1wuq:B, 1wuq:E, 1wuq:C, 1wuq:D, 1wur:A, 1wur:B, 1wur:E, 1wur:C, 1wur:D |
| 5 | 8csq:a | 263 | 54 | 0.1310 | 0.0722 | 0.3519 | 0.57 | |
| 6 | 4xqk:A | 1517 | 85 | 0.1724 | 0.0165 | 0.2941 | 1.5 | 4xqk:B |
| 7 | 3ihg:A | 535 | 26 | 0.0759 | 0.0206 | 0.4231 | 1.9 | 3ihg:B, 3ihg:C |
| 8 | 7x54:A | 285 | 81 | 0.1448 | 0.0737 | 0.2593 | 4.2 | 7x54:B, 7x54:C, 7x54:D, 7x54:E, 7x55:A, 7x55:B, 7x55:C, 7x55:D, 7x55:E, 7x56:A, 7x56:B, 7x56:C, 7x56:D, 7x56:E, 7x59:A, 7x59:B, 7x59:C, 7x59:D, 7x59:E |
| 9 | 3no3:A | 238 | 92 | 0.1655 | 0.1008 | 0.2609 | 6.4 | |
| 10 | 5f55:A | 705 | 41 | 0.1103 | 0.0227 | 0.3902 | 9.0 | 5f54:A, 5f56:A, 6lrd:A |
umich.edu