NYLFEYAPDVLESFPNKHVNRDYFVKFNCPEFTSLAPKTGQPDFATIYISYIPDEKMVESKSLKLYLFSFRNHGDFHEDC
MNIIMNDLIELMDPRYIEVWGKFTPRGGISIDPYTNYGKPGTKYEKMAEYRMMNHDLYPETIDNR
The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4f8b:B | 145 | 145 | 0.9931 | 0.9931 | 0.9931 | 3.64e-107 | 4f8b:A, 4f8b:C, 4f8b:D, 4f8b:E, 4fgc:A, 4fgc:B, 4fgc:C, 4fgc:D, 4fgc:E, 5udg:A, 5udg:D, 5udg:E |
2 | 3s19:A | 261 | 111 | 0.2345 | 0.1303 | 0.3063 | 1.12e-11 | 3bp1:A, 3bp1:B, 3bp1:C, 3bp1:D, 4ghm:A, 4ghm:B, 4iqi:A, 4iqi:B, 3rzp:A, 3rzp:B, 3rzp:C, 3rzp:D, 3s19:B, 3s19:C, 3s19:D, 3uxj:A, 3uxj:B, 3uxj:C, 3uxj:D, 3uxv:A, 3uxv:B, 3uxv:C, 3uxv:D |
3 | 3s19:A | 261 | 81 | 0.1724 | 0.0958 | 0.3086 | 9.6 | 3bp1:A, 3bp1:B, 3bp1:C, 3bp1:D, 4ghm:A, 4ghm:B, 4iqi:A, 4iqi:B, 3rzp:A, 3rzp:B, 3rzp:C, 3rzp:D, 3s19:B, 3s19:C, 3s19:D, 3uxj:A, 3uxj:B, 3uxj:C, 3uxj:D, 3uxv:A, 3uxv:B, 3uxv:C, 3uxv:D |
4 | 8csq:a | 263 | 54 | 0.1310 | 0.0722 | 0.3519 | 0.58 | |
5 | 4xqk:A | 1517 | 85 | 0.1724 | 0.0165 | 0.2941 | 1.4 | 4xqk:B |
6 | 3ihg:A | 535 | 26 | 0.0759 | 0.0206 | 0.4231 | 1.8 | 3ihg:B, 3ihg:C |
7 | 5jyx:B | 109 | 69 | 0.1034 | 0.1376 | 0.2174 | 3.7 | 5jyx:A, 5jyx:E, 5jyx:C, 5jyx:J, 5jyx:D, 5jyx:H, 5jyx:F, 5jyx:O, 5jyx:G, 5jyx:L, 5jyx:I, 5jyx:K, 5jyx:M, 5jyx:N |
8 | 7x54:A | 285 | 81 | 0.1448 | 0.0737 | 0.2593 | 3.9 | 7x54:B, 7x54:C, 7x54:D, 7x54:E, 7x55:A, 7x55:B, 7x55:C, 7x55:D, 7x55:E, 7x56:A, 7x56:B, 7x56:C, 7x56:D, 7x56:E, 7x59:A, 7x59:B, 7x59:C, 7x59:D, 7x59:E |
9 | 1wm9:A | 185 | 65 | 0.1103 | 0.0865 | 0.2462 | 6.9 | 1wm9:B, 1wm9:C, 1wm9:D, 1wm9:E, 1wuq:A, 1wuq:B, 1wuq:E, 1wuq:C, 1wuq:D, 1wur:A, 1wur:B, 1wur:E, 1wur:C, 1wur:D |
10 | 3qhb:A | 179 | 37 | 0.0759 | 0.0615 | 0.2973 | 7.3 | 3qhb:B, 3qhc:A, 3qhc:B, 3sid:A, 3sid:B |
11 | 5f55:A | 705 | 41 | 0.1103 | 0.0227 | 0.3902 | 9.0 | 5f54:A, 5f56:A, 6lrd:A |