NYIKPTKVNKNKEGLNIDGKEVLAGSTNYYELTWDLDQYKGDKSSKEAIQNGFYYVDDYPEEALDVRPDLVKVADEKGNQ
VSGVSVQQYDSLEAAPKKVQDLLKKANITVKGAFQLFSADNPEEFYKQYVATGTSLVITDPMTVKSEFGKTGGKYENKAY
QIDFGNGYATEVVVNNVPKITPKKDVTVSLDPTSENLDGQTVQLYQTFNYRLIGGLIPQNHSEELEDYSFVDDYDQAGDQ
YTGNYKTFSSLNLTMKDGSVIKAGTDLTSQTTAETDATNGIVTVRFKEDFLQKISLDSPFQAETYLQMRRIAIGTFENTY
VNTVNKVAYASNTVRTTT
The query sequence (length=338) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7l0o:A | 479 | 331 | 0.9379 | 0.6618 | 0.9577 | 0.0 | 7l0o:B, 2woy:A, 2wqs:A, 2wza:A |
2 | 6e3f:A | 497 | 331 | 0.6775 | 0.4608 | 0.6918 | 4.77e-171 | 3opu:A, 3opu:B, 3opu:C, 3opu:D, 3opu:E, 3opu:F, 3qe5:A, 3qe5:B |
3 | 4tsh:B | 485 | 330 | 0.6183 | 0.4309 | 0.6333 | 3.00e-153 | |
4 | 4ofq:A | 337 | 341 | 0.3609 | 0.3620 | 0.3578 | 6.82e-57 | 4ofq:B |
5 | 8beg:A | 650 | 341 | 0.2988 | 0.1554 | 0.2962 | 4.53e-33 | 8beg:B |
6 | 8beg:A | 650 | 215 | 0.1834 | 0.0954 | 0.2884 | 2.92e-11 | 8beg:B |
7 | 4mng:E | 228 | 59 | 0.0533 | 0.0789 | 0.3051 | 0.37 | 4mng:F |
8 | 3slk:A | 747 | 41 | 0.0503 | 0.0228 | 0.4146 | 1.1 | 3slk:B |
9 | 5d2e:A | 485 | 34 | 0.0296 | 0.0206 | 0.2941 | 2.4 | |
10 | 5y5w:B | 195 | 78 | 0.0592 | 0.1026 | 0.2564 | 2.5 | 7ea1:C, 6i8b:B, 6i8b:E, 6i8l:B, 6i8y:A, 6qpl:B |
11 | 5mru:A | 173 | 101 | 0.0858 | 0.1676 | 0.2871 | 3.3 | |
12 | 6fbk:A | 83 | 37 | 0.0355 | 0.1446 | 0.3243 | 4.2 | |
13 | 2dy1:A | 660 | 43 | 0.0414 | 0.0212 | 0.3256 | 5.1 | 1wdt:A |
14 | 3cuf:A | 314 | 102 | 0.0651 | 0.0701 | 0.2157 | 5.1 | 3cug:A, 3cuh:A, 3cui:A, 3cuj:A, 1exp:A, 1fh7:A, 1fh8:A, 1fh9:A, 1fhd:A, 2his:A, 1j01:A, 2xyl:A |
15 | 4n0y:L | 212 | 26 | 0.0355 | 0.0566 | 0.4615 | 7.9 | |
16 | 1jtd:B | 273 | 39 | 0.0414 | 0.0513 | 0.3590 | 8.3 | |
17 | 4go4:A | 487 | 41 | 0.0296 | 0.0205 | 0.2439 | 9.1 | 4go4:B, 4go4:C, 4go4:D, 4go4:E, 4go4:F, 4go4:G, 4go4:H |