BioLiP

>protein
NYENLSKLLTRYSTLNTLIKLSADPSAINAARENLGASAKNLIGDTKNSPAYQAVLLAINAAVGFWNVLGYATQCGGNAN
GQESTSSTTIFNNEPGYRSTSITCSLNRYKPGYYGPMSIENFKKLNEAYQILQTALNKGLPALKENNGTIKDVTYSYICY
GEGNNNCEIKLADGQKLQQNGGSETTTQTIDGKTVSTTISSKVVDSTAADNTYKQSYTEITNALKDVPDSAQALLAQAST
LINTINTACPYFSVTNKSGGPQMEPTRGKLCGFTEEISAIQKMITDAQELVNQTSVINEHEQSTPVGGNNGKPFNPFTDA
SFAQGMLANASAQAKMLNLAHQVGQTINPDNLTGTFKNFVTGFLATCNNKGSPPGTVTTQTFASGCAYVEQTITNLNNSI
AHFGTQEQQIQQAENIADTLVNFGSH

The query sequence (length=426) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5f93:B	426	426	1.0000	1.0000	1.0000	0.0	5f7m:A, 5f7m:B, 5f7n:A, 5f7n:B, 5f7w:A, 5f7w:B, 5f7y:A, 5f7y:B, 5f8r:A, 5f8r:B, 5f93:A, 5f93:E, 5f93:G, 5f97:A, 5f97:B, 5f97:C, 5f97:D, 5f9a:A, 5f9d:A
2	4zh7:A	485	428	0.7981	0.7010	0.7944	0.0
3	6avz:B	347	417	0.3075	0.3775	0.3141	1.11e-36
4	6leb:A	315	106	0.0704	0.0952	0.2830	0.82	6leb:B, 6lxs:A
5	8a0c:A	1116	60	0.0469	0.0179	0.3333	2.1	8a0c:B, 8a0m:A, 8a0m:C
6	6rm3:LD0	282	73	0.0376	0.0567	0.2192	2.3
7	7bkb:H	438	66	0.0399	0.0388	0.2576	2.6	7bkb:h, 7bkc:H, 7bkc:h
8	3rbh:D	410	92	0.0540	0.0561	0.2500	3.0	3rbh:C
9	4g7e:B	833	24	0.0258	0.0132	0.4583	3.2
10	3plx:B	101	51	0.0376	0.1584	0.3137	4.5
11	2iw3:B	980	34	0.0376	0.0163	0.4706	5.3	7b7d:EF, 2iw3:A, 2iwh:A, 2iwh:B
12	7ohu:P	108	56	0.0399	0.1574	0.3036	7.0	7ohp:P
13	7olc:La	148	24	0.0211	0.0608	0.3750	9.3	7old:La, 8oo0:La, 7z3n:La, 7z3o:La

[Back]