NYDPFVRHSVTVKADRKTAFKTFLEGFPEWWPNNFRTTKVGAPLGVDKKGGRWYEIDEQGEEHTFGLIRKVDEPDTLVIG
WRLNGFGRIDPDNSSEFTVTFVADGQKKTRVDVEHTHFDRMGTKHAKRVRNGMDKGWPTILQSFQDKIDEEGAKK
The query sequence (length=155) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2gkd:A | 155 | 155 | 1.0000 | 1.0000 | 1.0000 | 1.74e-113 | 2l65:A |
2 | 5z36:A | 154 | 123 | 0.2903 | 0.2922 | 0.3659 | 5.12e-15 | 5z4f:A |
3 | 7adr:A | 473 | 49 | 0.0839 | 0.0275 | 0.2653 | 2.2 | 7adr:D, 7ady:A, 7ady:D, 7aiz:A, 7aiz:D, 6fea:A, 6fea:D, 5n6y:A, 5n6y:D |
4 | 8i01:A | 594 | 37 | 0.0903 | 0.0236 | 0.3784 | 3.6 | 8beo:A, 8beo:B, 8beo:C, 8beo:E, 8beo:D, 8beo:F, 8i01:B, 8i01:C, 8i01:E, 8i01:D, 8i01:F, 8i05:A, 8i05:B, 8i05:C, 8i05:E, 8i05:D, 8i05:F, 8i07:A, 8i07:B, 8i07:C, 8i07:E, 8i07:D, 8i07:F, 8i08:A, 8i08:B, 8i08:C, 8i08:E, 8i08:D, 8i08:F, 2pan:A, 2pan:B, 2pan:C, 2pan:D, 2pan:E, 2pan:F |
5 | 6z1p:AB | 264 | 65 | 0.1032 | 0.0606 | 0.2462 | 5.0 | |
6 | 5iku:A | 240 | 50 | 0.1032 | 0.0667 | 0.3200 | 5.1 | 4hpk:A, 4hpk:B, 1nqd:A, 1nqd:B, 2o8o:A, 2o8o:B |
7 | 2uvf:A | 571 | 67 | 0.1097 | 0.0298 | 0.2537 | 6.8 | |
8 | 6zxu:A | 701 | 41 | 0.0968 | 0.0214 | 0.3659 | 7.0 | 4ras:A, 4ras:B, 4ras:C, 6zxu:B, 6zxu:C, 6zxx:A, 6zxx:B, 6zxx:C, 6zy0:A, 6zy0:B, 6zy0:C, 6zy1:A, 6zy1:B, 6zy1:C |
9 | 7exf:B | 719 | 37 | 0.0968 | 0.0209 | 0.4054 | 7.1 | 7exf:A, 7exg:B, 7exg:A, 7exh:B, 7exh:A, 7exj:A, 7exj:B, 7exq:A, 7exq:B, 7exr:A, 7exr:B |
10 | 1ksk:A | 234 | 88 | 0.1419 | 0.0940 | 0.2500 | 7.3 | 1ksl:A, 1ksv:A |
11 | 6jv0:A | 273 | 35 | 0.0839 | 0.0476 | 0.3714 | 7.7 | 6juz:A, 6jv1:A |
12 | 6jg1:A | 606 | 46 | 0.0968 | 0.0248 | 0.3261 | 9.5 | 1ex1:A, 1ieq:A, 1iev:A, 1iew:A, 1iex:A, 1j8v:A, 6jg2:A, 6jg6:A, 6jg7:A, 6jga:A, 6jgb:A, 6jgc:A, 6jgd:A, 6jge:A, 6jgg:A, 6jgk:A, 6jgl:A, 6jgn:A, 6jgo:A, 6jgp:A, 6jgq:A, 6jgr:A, 6jgs:A, 6jgt:A, 6k6v:A, 6kuf:A, 6l1j:A, 6lbb:A, 6lbv:A, 6lc5:A, 1lq2:A, 6md6:A, 6mi1:A, 3wlh:A, 3wlj:A, 3wlk:X, 3wll:A, 3wlo:A, 3wlp:A, 1x38:A, 1x39:A |