Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
NVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLD

The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2km0:A 74 59 1.0000 0.7973 1.0000 5.39e-38 3dso:A, 2lel:A, 3n7d:A, 3n7d:B, 3n7e:A, 3n7e:B
2 4rel:A 446 41 0.2542 0.0336 0.3659 1.3 4rem:A, 4ren:A, 4whm:A
3 3kow:B 728 38 0.2373 0.0192 0.3684 1.7 3kow:A, 3kow:C, 3kow:D, 3kox:A, 3kox:B, 3kox:C, 3kox:D, 3koy:A, 3koy:B, 3koy:D, 3koy:C, 3koz:A, 3koz:B, 3koz:C, 3koz:D, 3kp0:A, 3kp0:B, 3kp0:C, 3kp0:D, 3kp1:C, 3kp1:A, 3kp1:D, 3kp1:B
4 8d1u:A 318 44 0.1695 0.0314 0.2273 3.0 5bnm:A, 5bnr:A, 5bns:A, 5bns:B, 1ebl:A, 1ebl:B, 2eft:A, 2eft:B, 2gyo:A, 1hnd:A, 1hnh:A, 1hnj:A, 1mzs:A, 6x7r:A, 4z8d:A, 4z8d:B
5 4bfr:A 855 28 0.1864 0.0129 0.3929 4.9 4bfr:B
6 2y3a:A 976 28 0.1864 0.0113 0.3929 4.9

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218