BioLiP

>protein
NVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKD
QVILLNKHIDAYKTFP

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7o36:C	113	96	1.0000	0.8496	1.0000	3.90e-70	7n0i:D, 7o35:C, 7o35:D, 7o36:A, 7o36:B, 7o36:D, 7uxz:AAA, 7xxk:A, 7xxk:B, 7xxk:C, 7xxk:E
2	6g13:B	113	101	0.5521	0.4690	0.5248	3.00e-29	6g13:A
3	7b93:R	96	23	0.1146	0.1146	0.4783	2.2	7ak5:R, 7ak6:R, 8c2s:R, 8ca3:R, 6g2j:R, 6g72:R, 8iao:R, 8iap:R, 8ib4:R, 8ib5:R, 8ib9:R, 8iba:R, 8ibd:R, 8ibe:R, 8ic2:R, 8ic3:R, 8olt:R, 8om1:R, 7psa:R, 8pw5:7, 8pw6:7, 8pw7:7, 8rgp:7, 8rgq:7, 8rgr:7, 8rgt:7, 6zr2:R, 6ztq:R
4	5xf9:D	455	75	0.2188	0.0462	0.2800	3.9	5xf9:H, 5xfa:D, 5xfa:H
5	6s73:A	269	53	0.1458	0.0520	0.2642	5.2	5de2:A, 5de2:B, 6s73:B, 6s73:C, 6s75:A, 6s75:B, 6s75:C, 2wqn:A
6	2fna:A	352	17	0.1042	0.0284	0.5882	6.0	2fna:B
7	8wex:B	388	58	0.1354	0.0335	0.2241	8.1	8wex:A
8	6f0k:B	961	41	0.1354	0.0135	0.3171	8.2
9	9f17:A	413	28	0.0938	0.0218	0.3214	8.7	9f17:B, 7pvo:A, 8qwa:A, 6zxq:A
10	6skz:A	2638	22	0.1042	0.0038	0.4545	9.2	6sl0:A, 6sl0:B
11	6sl1:A	2652	22	0.1042	0.0038	0.4545	9.2	6sky:A, 6sky:B

[Back]