BioLiP

>protein
NVTLWGDANCDGIVDISDAVIIMQSLSNPSKFGRNGNDEHHITAQGELNGDVNENGNGITNADALAIQKYLLNLIGNLT

The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5m2s:B	79	79	1.0000	1.0000	1.0000	1.06e-52
2	5m2o:B	74	72	0.4684	0.5000	0.5139	2.35e-19
3	5n5p:B	87	83	0.3418	0.3103	0.3253	1.33e-05	5n5p:D
4	2ccl:B	62	72	0.2658	0.3387	0.2917	0.021	2ccl:D, 1ohz:B
5	4dh2:B	72	75	0.3038	0.3333	0.3200	0.034	4dh2:D
6	2y3n:D	49	47	0.2278	0.3673	0.3830	0.038
7	2y3n:B	60	25	0.1392	0.1833	0.4400	0.45
8	3mi0:R	239	39	0.1646	0.0544	0.3333	1.6	2fhh:H, 2fhh:C, 2fhh:E, 2fhh:G, 2fhh:J, 2fhh:L, 2fhh:N, 2fhh:P, 2fhh:R, 2fhh:T, 2fhh:V, 2fhh:X, 2fhh:Z, 2fhh:2, 3krd:C, 3krd:E, 3krd:R, 3krd:G, 3krd:N, 3krd:H, 3krd:J, 3krd:L, 3krd:P, 3krd:V, 3krd:T, 3krd:X, 3krd:Z, 3krd:2, 3mi0:C, 3mi0:E, 3mi0:G, 3mi0:H, 3mi0:J, 3mi0:L, 3mi0:N, 3mi0:P, 3mi0:T, 3mi0:V, 3mi0:X, 3mi0:Z, 3mi0:2, 6ocw:H, 6ocw:I, 6ocw:J, 6ocw:K, 6ocw:L, 6ocw:M, 6ocw:N, 6ocw:V, 6ocw:W, 6ocw:X, 6ocw:Y, 6ocw:Z, 6ocw:a, 6ocw:b, 6ocz:H, 6ocz:I, 6ocz:J, 6ocz:K, 6ocz:L, 6ocz:M, 6ocz:N, 6ocz:V, 6ocz:W, 6ocz:X, 6ocz:Y, 6ocz:Z, 6ocz:a, 6ocz:b, 6ode:H, 6ode:I, 6ode:J, 6ode:K, 6ode:L, 6ode:M, 6ode:N, 6ode:V, 6ode:W, 6ode:X, 6ode:Y, 6ode:Z, 6ode:a, 6ode:b, 5tho:H, 5tho:I, 5tho:J, 5tho:K, 5tho:L, 5tho:M, 5tho:N, 5tho:V, 5tho:W, 5tho:X, 5tho:Y, 5tho:Z, 5tho:a, 5tho:b, 5trg:H, 5trg:I, 5trg:J, 5trg:K, 5trg:L, 5trg:M, 5trg:N, 5trg:V, 5trg:W, 5trg:X, 5trg:Y, 5trg:Z, 5trg:a, 5trg:b, 5trr:H, 5trr:I, 5trr:J, 5trr:K, 5trr:L, 5trr:M, 5trr:N, 5trr:V, 5trr:W, 5trr:X, 5trr:Y, 5trr:Z, 5trr:a, 5trr:b, 5trs:H, 5trs:I, 5trs:J, 5trs:K, 5trs:L, 5trs:M, 5trs:N, 5trs:V, 5trs:W, 5trs:X, 5trs:Y, 5trs:Z, 5trs:a, 5trs:b, 5try:H, 5try:I, 5try:J, 5try:K, 5try:L, 5try:M, 5try:N, 5try:V, 5try:W, 5try:X, 5try:Y, 5try:Z, 5try:a, 5try:b, 5ts0:H, 5ts0:I, 5ts0:J, 5ts0:K, 5ts0:L, 5ts0:M, 5ts0:N, 5ts0:V, 5ts0:W, 5ts0:X, 5ts0:Y, 5ts0:Z, 5ts0:a, 5ts0:b, 6wnk:H, 6wnk:I, 6wnk:J, 6wnk:K, 6wnk:L, 6wnk:M, 6wnk:N, 6wnk:V, 6wnk:W, 6wnk:X, 6wnk:Y, 6wnk:Z, 6wnk:a, 6wnk:b
9	6kg9:A	67	48	0.2152	0.2537	0.3542	2.3	6kgc:B, 6kgd:B, 6kge:D, 6kge:B, 6kgf:D, 6kgf:B
10	1daq:A	71	75	0.2911	0.3239	0.3067	2.7	1dav:A, 2mte:A
11	7vwo:G	142	24	0.1392	0.0775	0.4583	9.1	7vwo:A, 7vwo:B, 7vwo:I
12	7clt:A	102	24	0.1013	0.0784	0.3333	9.8	7ygv:A, 7ygw:A

[Back]